KEGG   Conexibacter woesei: Cwoe_5005Help
Entry
Cwoe_5005         CDS       T01153                                 

Definition
(GenBank) Cupin 2 conserved barrel domain protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 AraC_binding Cupin_1 Cupin_3 MannoseP_isomer AraC_binding_2
Motif
Other DBs
NCBI-ProteinID: ADB53416
UniProt: D3FCC1
Position
complement(5334654..5335421)
Genome map
AA seq 255 aa AA seqDB search
MSAATLIPAAGPLADATAGGHLELVSQFEVLPGGHVNPHSHPTHEFYLVRSGRGLMTVGE
RAWEIVPGDLVTIPSEVVHSLEPVGDEPIRCFCFAVGDAGAGPVDYGTDGTEDASGLASA
DRSALADSPDSPVESAPATLPPLQVRNPRDHEPAMEHLGTVAVWWTVPPRELRDATLGGR
LTAVTRHDWTAGGKRDIPASPALRVYCVLDGVGEVVAGDRRRALGDDDVVLLAPGVAHRF
DGPLSLIAIDYEVTA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgccacgctgatccccgccgccggaccgctcgcggacgcgaccgccggcggc
cacctggagctggtgagccagttcgaggtgctgccgggcggccacgtcaacccccacagc
cacccgacgcacgagttctacctcgtccgctccggccgcggactgatgaccgtcggcgag
cgcgcgtgggagatcgtcccgggcgacctcgtgacgatcccgtccgaggtcgtgcacagc
ctggagccggtcggcgacgagccgatccgctgcttctgcttcgccgtcggcgacgcggga
gcgggtccggtcgactacggcaccgacggcaccgaagacgcgagcgggctcgcgtccgcc
gaccggtccgcgctcgccgactcgcccgactcgcccgtcgagtccgcacccgcgacgctc
ccgccgctccaggtccgcaacccgcgcgaccacgagccggcgatggagcacctcggcacg
gtcgccgtctggtggacggtcccgccgcgcgagctgcgcgacgcgacgcttggcggcagg
ctgaccgcggtcacgcggcacgactggaccgcgggcgggaagcgcgacatacccgcgtcc
cccgcgctgcgcgtctactgcgtgctcgacggcgtcggcgaggtcgtcgcgggcgacaga
aggagagcgctcggcgacgacgacgtcgtgctcctcgcgcccggcgtcgcgcaccgcttc
gacggcccgctctccctgatcgcgatcgactacgaggtgactgcatga

DBGET integrated database retrieval system