KEGG   Conexibacter woesei: Cwoe_5007Help
Entry
Cwoe_5007         CDS       T01153                                 

Definition
(GenBank) oxidoreductase domain protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA NAD_binding_3 GFO_IDH_MocA_C CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ADB53418
UniProt: D3FCC3
Position
complement(5336227..5337306)
Genome map
AA seq 359 aa AA seqDB search
MRIALIGCGWIVERSHVPALRDAVGIEVVAVADTSIERAQIVAKALGLPQSACTTDHRAL
LDRADVDAVSIGTPPDSHRALVEEAAAAGKHVLCEKPLATTLADADAILAACERAGVQLG
LFHNYLWYPETQEALKLIREGAIGEVVATEISGFGLRPWVGAEQGAPGWRHRLGSSGGGA
LMDAGVHALYLTEAYHGAPAERIGATVRRGDDGVDTWAFCQLHFPGGGFGMVNVAWGEGD
ARLSIMGTEGHITFLFDEGTGYYGMPARGFKVGRVGSDGRIWHRPLTWYRLFMPELFSDF
AAAVDHGEPSRYAAHGAEGRRAIELALGAYRAAEEGATVALPLTAADPVYERGYAALTA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgccctgatcggctgcggctggatcgtcgagcgcagccacgtcccggcgctg
cgcgacgccgtcgggatcgaggtcgtcgccgtcgccgacacgtcgatcgagcgcgcgcag
atcgtcgccaaggcactcggcctgccgcagtccgcgtgcacgaccgaccaccgcgcgctg
ctcgaccgcgccgatgtcgacgccgtcagcatcgggacgccgcccgactcccaccgcgcg
ctcgtcgaggaggcggcggcggccggcaagcacgtgctgtgcgagaagccgctcgcgacg
acgctcgccgacgccgacgcgatcctcgccgcgtgcgagcgggccggcgtccagctcggc
ttgttccacaactacctctggtacccggagacgcaggaggcgctcaagctgatccgcgag
ggcgcgatcggcgaggtcgtcgcgaccgagatcagcggcttcgggctgcgcccctgggtc
ggtgccgagcagggcgcgcccggctggcgccacagactcggctcctccggcggcggcgcg
ctgatggacgccggcgtccacgcgctctacctgaccgaggcctaccacggcgcgccggcc
gagcggatcggcgcgaccgtccgcagaggcgacgacggcgtcgacacatgggcgttctgc
cagctgcacttccccggcggcggcttcgggatggtcaacgtcgcctggggcgagggcgac
gcccgcctctcgatcatgggcaccgagggccacatcacgttcctgttcgacgagggcacc
ggctactacgggatgccggcgcgcggcttcaaggtcggcagagtcggcagcgacgggcgc
atctggcaccgtccgctgacctggtatcggctcttcatgcccgagctgttcagcgacttc
gccgccgccgtcgaccacggcgagccgtcgcgctacgccgcccacggcgccgagggccgc
cgcgcgatcgagctggcgctcggcgcctaccgcgccgccgaggagggcgcgacggtcgca
ctgccgctgaccgccgccgaccccgtctacgagcgcggctacgcggcgttgaccgcctga

DBGET integrated database retrieval system