KEGG   Conexibacter woesei: Cwoe_5011Help
Entry
Cwoe_5011         CDS       T01153                                 

Definition
(GenBank) oligopeptide/dipeptide ABC transporter, ATPase subunit
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_22 AAA_21 AAA_16 AAA TniB SMC_N Sigma54_activat PRK RsgA_GTPase AAA_29 MMR_HSR1 NB-ARC SbcCD_C AAA_24 NACHT RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ADB53422
UniProt: D3FCC7
Position
complement(5341123..5342094)
Genome map
AA seq 323 aa AA seqDB search
MPEVLAVDGLVKQFEQRVGTFRHATLHAVDGVSLTVDSDDCVGVVGESGCGKSTLARMMV
GLERPTAGAVRFDGGEITADGDWKQLRRAVQYVFQDPYGSLPPKMSIGAVLEDPLKIAKT
GDAASRRARVERAVELVGLRASDLARYPSEFSGGQRQRISVARALIQDPRVVIFDEVTSG
LDVSIQAQVLNLLVELQNSLSVGYVFISHDLRVIRYLARSVVVMYLGRVVEAGPVEDVFA
RPLHPYTQGLLRSIPDHSRLTAGGPRQRLARIGGEPPSPVERPPGCPFAPRCPAAQSLCR
EQEPGESVVEGVRVRCHFPGAAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggtgctggcggtcgacggactcgtgaagcagttcgagcagcgcgtcgggacg
ttcagacacgcgaccctccacgcggtcgacggcgtctcgctgacggtcgactccgacgac
tgcgtcggcgtcgtcggcgagagcggctgcggcaagtcgacgctcgcgcggatgatggtc
ggcctggagcggccgaccgccggcgcggtccgcttcgacggcggcgagatcaccgccgac
ggcgactggaagcagctccgccgcgcggtccagtacgtcttccaggacccgtacggatcg
ctgccgccgaagatgtcgatcggcgccgtgctggaggacccgctcaagatcgccaagacg
ggcgacgccgcctcgcgccgcgcgcgcgtcgagagagcggtcgagctggtcggcctgcgc
gcgagcgacctcgcgcggtacccgtcggagttcagcggcggccagcgccagcgcatcagc
gtcgcgcgcgccctgatccaggacccgcgcgtggtgatcttcgacgaggtcacctccggc
ctcgacgtctcgatccaggcgcaggtgctgaacctgctcgtcgagctgcagaactcgctc
tcggtcggctacgtcttcatctcgcacgacctgcgcgtgatccgctacctcgcgcgctcg
gtcgtcgtgatgtacctcggccgcgtcgtcgaggcgggaccggtcgaggacgtcttcgcg
cggccgctgcacccgtacacgcaggggctgctgcggtcgatccccgaccacagtcgcctc
accgccggcggcccgcgccagcgcctcgcgcgcatcggcggcgagccgccgagcccggtc
gaacgcccgcccggctgcccgttcgccccgcgctgtcccgccgcccagtcgctctgccgc
gagcaggagccgggcgagtccgtcgtcgagggcgtccgcgtccgctgccacttccccgga
gccgccgcatga

DBGET integrated database retrieval system