KEGG   Conexibacter woesei: Cwoe_5016Help
Entry
Cwoe_5016         CDS       T01153                                 

Definition
(GenBank) extracellular solute-binding protein family 5
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ADB53427
UniProt: D3FCD2
Position
complement(5346082..5347509)
Genome map
AA seq 475 aa AA seqDB search
MSAREQRTTIAIGNAEPPTSEHWDPHAALGLADNQIWSLVYDTLVSYDADGRVVGRLARK
WFRTAPTRLRVELRPGVVFSDGTPLTARDVRASLERIGDPLSRLVLSGKVVPGLRVEVLG
DHLLEIVTPKPFGPIERALAIAAIVPVADAEDPARFAQRPLGSGPFVFAGSDGGVVRLTA
NPAHWRGAPGVAAVELHYIEDPRERLEALLSGRIDIHTRASSIVLDAIAGDDAFDVTTMG
PASQFIYIPQHDGPLRDTRVRRAIAHAIDRRAIAKRILKLGEPAVSALPSSSIGFQPGRS
ELEYNPAKARELLAEAGHADGLRLSLASANLFAHQLEIDQLVRRSLQEVGIAVDLDVLES
GQFRSSFNRYALSFNAIGATSRDPDHLLTFFRPVVAQESMHLDDHKITELIERERQTSGK
ARLAAVNQAAQYLWENQVMIYVSDDVWYTAVSRRVQGYQRTPLEGEPLLWKATKA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcacgggagcagagaacgacgatcgcgatcggcaacgccgagccgcctacgtcc
gagcattgggacccccatgccgcgctcgggctcgccgacaaccagatctggtcgctcgtc
tacgacacgctggtctcctacgacgccgacggccgcgtcgtcggccggctcgcgcgcaag
tggttccgcaccgcgccgacgcgcctgcgcgtcgagctgcggcccggcgtcgtcttctcc
gacggcacgccgctgaccgcgcgcgacgtgcgcgccagcctggagcggatcggcgatccg
ctgtcgcgcctggtgctgtccggcaaggtcgtcccgggcctgcgcgtcgaggtgctcggc
gaccacctgctggagatcgtcacgccgaagccgttcgggccgatcgagcgcgcgctcgcg
atcgccgcgatcgtgcccgtcgccgacgccgaggaccccgcgcgcttcgcgcagcggccg
ctcggcagcgggccgttcgtgttcgccggctccgacggcggcgtcgtgcggctgaccgcg
aacccggcgcactggcgcggcgcgcccggcgtcgccgcggtcgagctgcactacatcgag
gatccgcgcgagcggctggaggcgctgctgtccgggcgcatcgacatccacacgcgcgcc
agctcgatcgtgctcgacgcgatcgcgggcgacgacgcgttcgacgtcacgacgatgggg
ccggcgagccagttcatctacatcccccagcacgacggccccctgcgtgacacgcgcgtg
cgccgcgcgatcgcccacgcgatcgaccgccgcgcgatcgccaagcggatcctcaagctc
ggcgagccggccgtctcggcgctgccgtcgtcgtcgatcggcttccagcccggcagatcg
gagctggagtacaacccggcaaaggcgcgcgagctgctcgccgaggccggccacgcggac
ggcctgcggctctcgctcgcctccgccaacctcttcgcccaccagctcgagatcgaccag
ctcgtccggcgctcgctccaagaggtcgggatcgccgtcgacctcgacgtgctggagagc
ggtcagttccgcagctccttcaatcgctacgccctctcgttcaatgcgatcggcgccact
tcgcgcgaccccgaccacctgctgacgttcttccggccggtcgtcgcgcaggagtcgatg
cacctcgacgaccacaagatcaccgagctgatcgagcgtgagcggcagacctccggcaag
gcccgcctcgccgccgtcaaccaggcggcgcagtacctctgggagaaccaagtgatgatc
tacgtgtccgacgacgtctggtatacggccgtcagtcgccgtgtccagggctatcagcgc
acgccgctcgaaggcgagccgctgctgtggaaggcgacgaaggcgtag

DBGET integrated database retrieval system