KEGG   Conexibacter woesei: Cwoe_5017Help
Entry
Cwoe_5017         CDS       T01153                                 

Definition
(GenBank) transcriptional regulator, PucR family
  KO
K09684  purine catabolism regulatory protein
Organism
cwo  Conexibacter woesei
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cwo03000]
    Cwoe_5017
Transcription factors [BR:cwo03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Cwoe_5017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PucR HTH_30 HTH_8 HTH_23 DUF4096
Motif
Other DBs
NCBI-ProteinID: ADB53428
UniProt: D3FCD3
Position
5347662..5349194
Genome map
AA seq 510 aa AA seqDB search
MTHRSASRVGRVAPGLHAVLSITDIVELPGLEIRLVAGHVGDRNAIRWLHISELEDPTPE
LDGGELLLTGGLGLGATAASQRRYVRRLAEHGAAGLGIAVGEALPQIPAAVVAEADALGF
PVLLVPASTPFNTLTKLTLPQLAADPVAQALEVHEQLIETVLGGGGPRDLLRILGGTLGG
TLVLSDDHGTIAEHHSGEHHSGERHELGDDALALPIGDGPGAATLRAAREERPFGDYERL
VLRHGQNALALELARRQAVLAAELRLAGDLFDDLEQERLDLRETARRLAAFGLDANRSHA
ALLGVPGGDANAALLRDLIARHLDRQAISHLSAARHNGVAFLVNAPSEEALFALAEALVR
AAPGMRVAVGRSANGLGLGRSLLEARAALDASGAAVVSYRDLSSFELLLSVPVPVLEAYV
DRVLGPTASNGWLVETLSVLLESGCRWKDAAEQLGVHRHTLRYRMDRLQEQTGRHPDQPG
QRMELWLAVKAIQAIAMRGGGSYEPRTDRV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaccgatccgccagtagagtcggccgcgtcgcacccgggcttcatgcagtgctg
tcgatcacggacatcgtcgagttgcccggcctcgagatccgtctcgtcgccggtcacgtc
ggcgaccgcaacgcgatccgctggctgcacatctccgagctggaggacccgacgccggag
ctggacggcggcgagctgctactgaccggcggcctcgggctcggcgcgaccgccgcctcg
cagcgccgttacgtccgccgcctcgccgagcacggcgccgcgggcctggggatcgccgtc
ggcgaagcgctgccgcagatccccgccgccgtcgtcgccgaggccgacgcgctcggcttt
cccgtcctgctggtgccggcgagcacgccgttcaacacgctcacgaagctgacgctcccg
cagctcgctgccgacccagtcgcgcaggcgctggaggtccacgagcagctgatcgagacg
gtcctcggcggcggcgggccgcgcgacctgctgcggatcctcggcgggacgctcggcggc
acgctggtgctctccgacgatcacggcacgatcgccgagcaccactcgggcgagcaccac
agcggcgagcgccacgagctgggcgacgacgcgctcgcactcccgatcggcgacggaccg
ggcgccgcgacgctgcgcgccgcgcgcgaggagcggccgttcggcgactacgagcggctc
gtgctgcgccacggccagaacgcgctcgcgctggagctggcgcgccgccaggcggtgctc
gcggccgagctgcggctcgccggcgacctcttcgacgacctcgagcaggagcgcctggac
ttgcgcgagaccgcgcgccggctggccgcgttcgggctcgacgcgaaccgcagccacgcg
gcgctgctgggggttccgggcggtgacgccaacgcggcgctgctgcgcgacctgatcgcc
cgccacctcgaccgccaggcgatcagccacctgtcggccgcgcgccacaacggcgtcgcg
ttcctcgtcaacgcgccgagcgaggaggcgctgttcgcgctcgccgaggcgctcgtgcgc
gcggcgccggggatgcgcgtcgcggtcggccgctcggccaacgggctcggcctcggccgc
agcctgctggaggcgcgcgccgcgctcgacgcctccggcgccgccgtcgtctcctaccgc
gacctcagctcgttcgagctgctgctgagcgtgccggtgcctgtgctggaggcgtacgtc
gatcgcgtgctcggcccgaccgcctccaacggctggctcgtcgagacgctgagcgtgctg
ctggagtccggctgccgctggaaggacgccgccgagcagctcggcgtccaccggcacacg
ctgcgctaccgcatggaccgcctgcaggagcagaccgggcgccatcccgaccagcccggc
cagcggatggagctgtggctggcggtgaaggcgatccaggcgatagcgatgcgcggcggc
ggctcgtacgagccgcgcaccgatcgcgtctga

DBGET integrated database retrieval system