KEGG   Conexibacter woesei: Cwoe_5019Help
Entry
Cwoe_5019         CDS       T01153                                 

Definition
(GenBank) glycerate kinase
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
cwo  Conexibacter woesei
Pathway
cwo00260  Glycine, serine and threonine metabolism
cwo00561  Glycerolipid metabolism
cwo00630  Glyoxylate and dicarboxylate metabolism
cwo01100  Metabolic pathways
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cwoe_5019
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cwoe_5019
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cwoe_5019
Enzymes [BR:cwo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     Cwoe_5019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_kinase Phosphodiest Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ADB53430
UniProt: D3FCD5
Position
complement(5350953..5352041)
Genome map
AA seq 362 aa AA seqDB search
MLCAPDKLRGALDARGAAHALAEGARAAGGVPHELPIADGGEGTLDAFLDGATVHELTVE
DALGRPRSARLLELADAPDPATAAGGTFLVEAAEAVPLHALAEHERDVERASSYGAGELV
RAALDRGARRILIAVGGVATVDGGAGALQALGARCPRDGAGLLAAPEIDRSDLDPRLAGV
EIELLVDVAAPLTGPDGAAHRFGPQKGATPEQIAALDSALTRWADALGIDPATPGAGAAG
GLGAAFQAIGARTVAGADAVLELTGFDTLLAEADLVLTAEGSVDASTLQGKAVAAVVAHC
AKAGVPVEVFGGRVIDEAAVELRRRGARDVRPLGPAGRPLAEAFAAAADELAAAAEAATR
RT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgctctgcgccccggacaagctgcgcggcgcgctcgacgcgcgcggcgcggcgcacgcg
ctcgcggagggcgcgcgagcggccggcggagtgccgcacgagctgccgatcgccgacggc
ggcgagggaacgctcgacgcgttcctcgacggcgcgaccgtccacgagctgaccgtcgag
gacgcgctcggccgcccgcgcagcgcgcggctgctggagctggccgacgcgcccgacccg
gccacggccgccggggggacgtttctggtcgaggccgccgaggcggtgccgctgcacgcg
ctcgccgagcacgagcgcgacgtcgagcgggcgtcgtcctacggtgccggcgagctggtg
cgcgcggcgctcgaccgcggcgcgcggcggatcctgatcgccgtcggaggggtcgcgacg
gtcgacggcggcgcgggtgcgctgcaggcgctcggcgcgcgctgcccgcgcgacggcgcc
ggtctgctcgccgcgccggagatcgaccgcagcgacctcgacccgcgcctcgccggcgtc
gagatcgagctgctggtggacgtcgccgcgccgctgaccgggcccgacggcgccgcgcac
cgcttcggcccgcagaagggcgccacgccggagcagatcgccgcgctcgacagcgccctc
acgcgctgggccgacgcgctcgggatcgaccccgcgacgcccggcgccggcgcggccggc
ggcctcggcgccgccttccaggcgatcggcgcgcgcaccgtcgcgggcgccgacgccgtg
ctggagctgaccggcttcgacacgctgctggccgaggccgacctcgtgctgaccgccgag
ggatcggtcgacgcctcgacgctccagggcaaggcggtcgccgccgtcgtcgcgcactgc
gccaaggccggcgtcccggtcgaggtcttcggcggccgcgtcatcgacgaggccgccgtc
gagctgcggcgccgcggcgcgcgcgacgtgcgcccgctcggccccgccggccgcccgctc
gccgaggcgttcgcggcagccgcagacgagctggccgccgcggccgaggctgcgacgcgc
cggacctga

DBGET integrated database retrieval system