KEGG   Conexibacter woesei: Cwoe_5020Help
Entry
Cwoe_5020         CDS       T01153                                 

Definition
(GenBank) ABC-type phosphate transport system periplasmic component-like protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 LysR_substrate
Motif
Other DBs
NCBI-ProteinID: ADB53431
UniProt: D3FCD6
Position
5352229..5353071
Genome map
AA seq 280 aa AA seqDB search
MSQRAKGLAGALIVSAALLAGPASSHAATVFGSGSSASVPYLEALFKAYRKVDPKTKFVF
TANNGNAGAKDVQDGKSAFAIQTRPPLPSDSGLSYSKLFLDGLCVAVNPANSVSGLRIQQ
VADIFLGTVTEWPAVGSSLNAPISAFGRFSTAGLYTFFQSAVLRGQTQATNVTALDKDGE
VAVAVSRNQAGIGYVGLANSGPGSGVKRLSLDGQPCAPSAIRTLKYPLSRYAWLVLPARS
PNRTATKFGDWVRTSYAAGRVIDKAGAVPAFNAKKPPKKG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagagagccaagggcctcgccggtgcgctgatcgtctcggccgcactgctcgcg
gggccggcgtcgtcccacgccgcaacggtgttcgggtcgggatcgagcgccagcgtgccg
tacctggaggcgctcttcaaggcctacagaaaggtcgacccgaagacgaagttcgtcttc
accgccaacaacggcaacgccggcgccaaggacgtgcaggacggcaagagcgcgttcgcg
atccagacgcggccgccgctgccgtcggactccggactcagctactcgaagctcttcctc
gacgggctgtgcgtcgcggtcaaccccgccaacagcgtctcggggctgagaatccagcag
gtcgccgacatcttcctcggcacggtcacggagtggccggcggtcggctccagcctcaac
gcgccgatctcggcgttcggccgcttctcgaccgccgggctctacacgttcttccagagc
gccgtgctcagaggacagacgcaggcgacgaacgtgacagcgctcgacaaggacggcgag
gtcgccgtcgcggtgtcgagaaaccaggccgggatcggctacgtcggcctcgccaactcc
ggtccgggcagcggcgtcaagcggctcagcctcgacggtcagccgtgcgcgccgagcgcg
atccgcacgctcaagtacccgctgtcgcgctacgcctggctcgtgctgccggccagaagc
ccgaacagaaccgcgacgaagttcggcgactgggtgcggacgagctacgccgccggcaga
gtgatcgacaaggccggagcggtgccggcgttcaacgcgaagaagccgccgaagaagggc
tga

DBGET integrated database retrieval system