KEGG   Conexibacter woesei: Cwoe_5030Help
Entry
Cwoe_5030         CDS       T01153                                 

Definition
(GenBank) cytochrome bd ubiquinol oxidase subunit I
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:1.10.3.14]
Organism
cwo  Conexibacter woesei
Pathway
cwo00190  Oxidative phosphorylation
cwo01100  Metabolic pathways
cwo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cwoe_5030
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Cwoe_5030
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     Cwoe_5030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_I ISAV_HA DUF4225
Motif
Other DBs
NCBI-ProteinID: ADB53441
UniProt: D3FD49
Position
5361466..5362881
Genome map
AA seq 471 aa AA seqDB search
MNSLELARLQFGFTTLVHFAVIGVSIGLVFWVAAMQTRWHRTGDEKWLRLTRFYGKLMLL
SFAVGVLTGIMQTFQFGMNWSRFSAYVGDVFGAPLALEGLGAFFVEAVFLGLWMFGWGRL
PRRLHLACVWIVAGATVVSAYAILVANSWMQHPVGYELVDGSARLTDIVPVLFNLTVGLT
VAHVVSGALLAGTVVVLAIAAFHLLRGRDSAAFGAVARVAVFVGLFAALSTATFGHFQGM
LAMKQQPMKMAAAEALYETEKPAGLSLFALGGLSTNPGELIVDLKVPAALSLINQLSTQS
TVRGINDLQTEAEQRYGPGDYVPVVGLMYWSFRTMVGGGTALIAIMALGCWLAVRDRLAG
SRRFLQLALAATALPFLAQAGGWLLREGGRQPWVIDGLLRTDVANSPNVGAWTVGLSLAG
FAVFYGAVFFFAGRVAAHEVREGLEAPADGRASDSPPARGRRSPADLALTY
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagcctcgagttggcccgcctgcagttcggcttcaccacgctggtccacttcgcc
gtcatcggcgtctcgatcggcctcgtcttctgggtcgccgcgatgcagacccgctggcat
cgaaccggcgacgagaagtggctgcggctgacgcgcttctacggcaagctgatgctgctg
tcgttcgccgtcggcgtgctgacggggatcatgcagacgttccagttcggcatgaactgg
tcgcgcttctccgcctacgtcggcgacgtcttcggcgcgccgctggcgctcgaagggctc
ggcgcgttcttcgtcgaagcggtcttcctcggcctctggatgttcggctggggccggctg
ccgagacggctgcacctcgcctgcgtctggatcgtcgcgggcgcgacggtcgtctccgcc
tacgcgatcctcgtcgccaactcgtggatgcagcacccggtcggctacgagctggtcgac
ggcagcgcacggctgaccgacatcgtgccggtgctgttcaacctgaccgtcgggctgacg
gtcgcgcacgtcgtctccggcgcgctgctcgccggcacggtcgtcgtgctcgcgatcgcg
gcgttccacctgctgcgcggccgcgacagcgccgccttcggcgcggtcgccagagtcgcc
gtcttcgtcgggctgttcgcggcgctgtcgaccgcgaccttcggccacttccaggggatg
ctcgcgatgaagcagcagccgatgaagatggccgcggccgaggcgctgtacgagaccgag
aagccagccggcctgtcgctgttcgcgctcggcgggctctcgaccaaccccggcgagctg
atcgtcgacctgaaggtgccggcggcgctgtcgctgatcaaccagctgtcgacgcagtcg
accgtgcgcgggatcaacgacctgcagacggaggcggagcagagatacggcccgggcgac
tacgtcccggtcgtcgggctcatgtactggtcgttccgcacgatggtcggcggcggcacc
gcgctgatagcgatcatggcgctcggctgctggctcgccgtgcgcgaccgcctggccggc
tcgcgccgcttcctccagctcgcgctcgccgcgaccgcgctgccgttcctggcgcaggcc
ggcggctggctgctgcgcgagggcgggcgccagccgtgggtgatcgacggcctgctgcgg
accgacgtcgcgaactcgccgaacgtcggcgcgtggacggtcggtctctcgctcgccggc
ttcgccgtcttctacggcgccgtcttcttcttcgccggccgcgtcgccgcgcacgaggtg
cgcgaggggctggaggcgccggcggacgggcgcgcctccgattcgccgcccgcgcgcggg
cgccgctcgcccgccgacctcgccctcacctactag

DBGET integrated database retrieval system