KEGG   Conexibacter woesei: Cwoe_5040Help
Entry
Cwoe_5040         CDS       T01153                                 

Definition
(GenBank) ABC transporter related protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_22 AAA_16 SMC_N Sigma54_activat AAA_21 oligo_HPY AAA_25 SbcCD_C AAA_29 AAA_24 sCache_3_2 AAA_33 DLIC AAA_23 PRK NACHT
Motif
Other DBs
NCBI-ProteinID: ADB53451
UniProt: D3FD59
Position
complement(5373326..5374114)
Genome map
AA seq 262 aa AA seqDB search
MILEARGLRKTFGGAVAVDDVSFALPEGGSLAIVGESGSGKTTVARMVVGLERPSGGEIL
FDGGDRTAPPRSRADWRRRGREVQIVFQDPYSSLDPRQSCADCLDEVLKLHFDLSAQARR
ARIAELADLVGLDERQRAARPKALSGGQRQRIGIARALAAEPRVLILDEAVAALDVSIQA
QILNLLADVREQTGVSYLFISHDLAVVRQITDDVVVMKSGRVVEQGATKAVLDNPQEEYT
QLLRASVPTAGWTPPRHAARAR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctggaggcgcgcgggctgcgcaagacgttcggcggcgcggtcgcggtcgacgac
gtgtcgttcgcgcttccggagggcggctcgctggcgatcgtcggcgagtccggctccggc
aagacgaccgtcgcgcggatggtcgtcgggctcgagcggccgagcggcggcgagatcctc
ttcgacggcggcgaccgcaccgccccgccgcgctcgcgtgccgactggcgcaggcgcggc
cgcgaggtccagatcgtcttccaggacccgtactcgtcgctcgacccgcgccagagctgc
gccgactgcctcgacgaggtgctgaagctgcacttcgacctgtctgcgcaagcgcgccgc
gcgcggatcgccgagctggccgacctcgtcggcctcgacgagcgccagcgggcagcgcgc
ccgaaggcgctgtccggcggtcagcggcagcggatcgggatcgcccgcgcgctcgcggcc
gagccgcgcgtgctgatcctcgacgaggcggtcgccgcgctcgacgtgtcgatccaggcg
cagatcctcaacctgctcgccgacgtgcgcgagcagaccggcgtctcctacctgttcatc
agccacgacctcgcggtcgtgcggcagatcaccgacgacgtcgtcgtgatgaagagcggc
cgcgtcgtcgagcagggcgccacgaaggccgtgctcgacaacccgcaggaggagtacacc
cagctcctgcgcgccagcgtcccgaccgccggctggaccccgccgcggcacgcggcgcgt
gcgaggtga

DBGET integrated database retrieval system