KEGG   Conexibacter woesei: Cwoe_5056Help
Entry
Cwoe_5056         CDS       T01153                                 

Definition
(GenBank) beta-lactamase domain protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: ADB53467
UniProt: D3FD75
Position
complement(5403441..5404640)
Genome map
AA seq 399 aa AA seqDB search
MPDTMTFQFLDVGMGDSTLVQIRRRDERFDRLVLVDCGERRTPLGVAPADALAYLTRAIG
ENSHARRRRRPYIDYLIITHPDGDHYNRVPDLLDATFPHYPTRRLRIGDLYYGGNAAEYG
RLITRTLVGRVNALDGLDPMSQNYHSRVDGANRLIAWRTFGDVNLYVLSANWPSRGTRDR
NVKSIVLMFELDGQKVILTGDATRATERHILRDVVGRDPSEVSCHALKLGHHGSNGSTSD
AWVAATAPFAIFASGDQVWAHPYCRPICKFIDGDHLRRQFRTNSYYTCGDLGRYFNNRTR
LAIGMNLFYEVARRRERLYDEDAQRNVWARRGTVYGVQWALSIVPRRRFELLRTDTCRPQ
DANVNRPFDCAAAVLGDGRRDELLALIDVLPAATDPAPA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacacgatgacgttccagttcctcgacgtcggcatgggcgacagcacgctcgtg
cagatacgtcgcagagatgaaagattcgaccgcctcgtgctggtcgactgcggcgagaga
cgcacgccgctgggtgtggcgccggcagacgcgctcgcatatctcacgagagcgatcgga
gagaacagccatgcgcgcagacgcagaagaccgtacatcgactacctgatcatcacccat
cccgacggggaccactacaacagagtccccgacctgctggacgcgacgttcccgcactac
ccgacgagaagactccgaatcggagacctgtactacggcggcaacgcggccgagtacggc
agattgatcacgagaacgctcgtcgggcgagtgaacgcgctcgacgggctcgacccgatg
tcgcagaactatcactcgagagtcgacggggcgaacagactgatcgcgtggaggacgttc
ggcgacgtcaacctctacgttctctccgcgaactggcccagccgcggcaccagagacaga
aacgtcaagagcatcgtgctgatgttcgagctggacggccagaaggtgatcctgacgggc
gacgcgacgagagcgaccgagagacacatcctcagagacgtcgtcgggagagatccgagc
gaggtcagctgtcacgcgctgaagctcggccatcacggcagcaacggatcgaccagcgat
gcgtgggttgccgccacggcaccgtttgcgatcttcgcctccggcgaccaggtgtgggct
cacccgtactgcagaccgatctgcaagttcatcgacggtgaccatctgcggagacagttc
agaacgaacagctactacacctgcggcgacctcggcagatatttcaacaatcgcaccaga
ctcgcgatcgggatgaacctcttctacgaggtcgcgagaagaagagagagactctacgac
gaggacgctcagagaaacgtgtgggcgagaagaggcaccgtctacggcgtgcaatgggcg
ctctcgatcgtgcccagaagaagattcgagctgctgcggacggacacctgccgtccgcag
gacgcgaacgtgaacagaccgttcgactgcgccgcggccgtgctcggcgacggccggcga
gacgagctgctggcgctgatcgacgtgctcccggccgcaaccgaccccgctcccgcctga

DBGET integrated database retrieval system