KEGG   Conexibacter woesei: Cwoe_5064Help
Entry
Cwoe_5064         CDS       T01153                                 

Definition
(GenBank) DNA-cytosine methyltransferase
  KO
K00558  DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
cwo  Conexibacter woesei
Pathway
cwo00270  Cysteine and methionine metabolism
cwo01100  Metabolic pathways
Module
cwo_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cwoe_5064
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cwo03032]
    Cwoe_5064
   03036 Chromosome and associated proteins [BR:cwo03036]
    Cwoe_5064
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:cwo02048]
    Cwoe_5064
Enzymes [BR:cwo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     Cwoe_5064
DNA replication proteins [BR:cwo03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    Cwoe_5064
Chromosome and associated proteins [BR:cwo03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Cwoe_5064
Prokaryotic defense system [BR:cwo02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    Cwoe_5064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_methylase FtsJ MTS Methyltransf_25 Methyltransf_15 Cons_hypoth95 SgrT
Motif
Other DBs
NCBI-ProteinID: ADB53475
UniProt: D3FD83
Position
5413315..5414589
Genome map
AA seq 424 aa AA seqDB search
MAKTKTLTAVDLFCGAGGLSQGLADAGMHVVAAADHDPDACATYRRNFPRTVLVEGDLTS
REKHEALLDALQGSDLDLLAGGPPCQAYSQVRNHDRLIDDPRNRLYREFVGLLQEIRPRT
LVLENVLGMSQLKGGAVRRQIEQDLSLQGAYDVISGVLDAGDFGTPQRRPRLVFIGVRTD
IGVAPGLPEGTGLSRALRNGHSGQPTEALFSLDRPLHEVLTDPGDRRAVTVQQALSDLIE
PGDVYSSRPQSAYQRWMRVKSKVPQDHTPSAIREDTRRRLQAIPPGGNVYDLPEELLRRY
LGDSKWGPAGNGERLARRHFYAYRRLHPDWLAWTANTKADFAYHYEVARGLSVREAARIQ
GFPDRFHFVTAPKGTPGQLRNGARHSRYRQVGNAVPPPLAAAIGRSVCDLLGAHDPAELA
APSN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagacgaaaaccctcaccgcagtagacctcttttgcggcgcaggaggcttgagc
cagggcctcgccgacgccggtatgcacgtcgttgctgctgcggatcatgaccctgatgcc
tgcgcgacgtaccggcggaatttcccaagaacagtccttgtcgaaggagacctcaccagt
cgggagaagcacgaagcgctcttggacgcgctgcagggctccgaccttgatctgcttgct
ggtggtccgccttgccaggcgtacagccaggtccgcaatcacgatcgcctgattgacgat
cctcgtaaccgcctgtaccgggagttcgttggcctcctccaagagatccgcccgcggacc
cttgtactcgaaaacgtcctgggaatgagccagctcaagggcggtgctgtccggcgtcag
atcgagcaagacctctcgctccaaggcgcctacgacgtaatctcaggagtcctggacgcc
ggcgacttcggaacgccgcagcggcgccctcggctcgtcttcatcggcgtgcgaacagac
atcggcgttgctcccggtctccccgagggcacagggctcagtcgtgcgctccgcaacggg
cacagcgggcaaccaaccgaagcgttgttcagcttggatcgtccgctgcacgaggtgctg
acggacccgggtgaccggcgtgctgtcacagtgcagcaggccctcagcgacctcatcgaa
cccggcgacgtgtacagcagcagacctcaatcggcgtatcagcgatggatgcgcgtgaag
agcaaagttcctcaggaccacactccgtccgcgatccgcgaagacacgcgccgacgcctt
caggcgatcccgccaggcggcaacgtctatgacctccctgaggaactcctccgacggtac
ctcggcgactcgaagtgggggcctgctggaaacggggagcgactcgcccgccgccatttc
tacgcctaccggcgtctgcatcccgactggcttgcgtggactgcgaacacaaaggcagac
tttgcataccactacgaggttgcccggggtctgtcagtccgcgaggccgcccgaatccaa
gggtttcctgatcgcttccactttgtgaccgcgccaaagggcacgcccggccagcttaga
aacggcgcacggcactctcggtaccgccaggtcgggaatgcggtgcccccgcctctggcc
gccgcgatcggacgctccgtttgcgatctcctcggcgcgcacgacccggccgaactcgca
gctcccagcaactga

DBGET integrated database retrieval system