KEGG   Conexibacter woesei: Cwoe_5071Help
Entry
Cwoe_5071         CDS       T01153                                 

Definition
(GenBank) Transketolase central region
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
cwo  Conexibacter woesei
Pathway
cwo00010  Glycolysis / Gluconeogenesis
cwo00020  Citrate cycle (TCA cycle)
cwo00620  Pyruvate metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Module
cwo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cwoe_5071
   00020 Citrate cycle (TCA cycle)
    Cwoe_5071
   00620 Pyruvate metabolism
    Cwoe_5071
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Cwoe_5071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADB53480
UniProt: D3FD88
Position
complement(5419213..5420190)
Genome map
AA seq 325 aa AA seqDB search
MSQVTYKEAIRRAQEDALAENDRVVLLGEDIAAAGGAFKVTDRLFERFGPERVLDTPISE
QAIVGAAIGAALKGRRPVAELMFADFAAVCFDQIANQLAKYRYMTGGQVTLPVTLRLSNG
AGGGFASQHSQTVENWFLNCPGLKVVVPGSPADAYGLFMAAVRDEDPVLFFEHKGMYNVK
GELGPAGEAIEIGRAGVIRSGTSATVVATQLMRQRAERVAEELAAEGIELELIDPRTVLP
LDLDTIGASVDKTGRLVVVQESPLGGSWGATVVAGVVAERFESLDAAPVLVSGPDTPVPY
AGPLEDAWLPSERHIAGEIRSLLGA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggtcacgtacaaggaggcgatccggcgcgcgcaggaggacgcgctcgccgag
aacgaccgcgtcgtgctgctgggcgaggacatcgccgcggccggtggcgcgttcaaggtc
accgacaggctgttcgagcgcttcggccccgagcgcgtgctcgacacgccgatctccgag
caggcgatcgtcggcgcggcgatcggcgcggcgctgaagggccggcgcccggtcgccgag
ctgatgttcgccgacttcgccgccgtctgcttcgaccagatcgccaaccagctcgcgaag
taccgctacatgacgggcggccaggtgacgctgcccgtcacgctgcgcctctccaacggc
gccggcggcggcttcgcctcccagcactcccagacggtcgagaactggttcctcaactgc
ccggggctgaaggtcgtcgtgccggggtcgccggccgacgcgtacgggctgttcatggcc
gcggtgcgcgacgaggacccggtgctcttcttcgagcacaagggcatgtacaacgtcaag
ggcgagctggggccggccggcgaggcgatcgagatcggcagagcgggcgtgatccgcagc
ggcacgagcgcgacggtcgtcgcgacgcagctgatgcgccagcgcgccgagcgcgtcgcg
gaggagctggccgccgaggggatcgagctggagctgatcgacccgcgcacggtcctgccg
ctcgacctcgacacgatcggcgccagcgtcgacaagaccggccgcctcgtcgtcgtgcag
gagtcgccgctcggcggcagctggggcgcgaccgtcgtcgccggcgtcgtcgccgagcgc
ttcgagtcgctggacgccgcgccggtactcgtcagcggtcccgacacaccagtcccgtac
gccgggccgctggaggacgcatggctgccgagcgagagacacatcgccggcgagatccgt
agcctgctcggagcctga

DBGET integrated database retrieval system