KEGG   Conexibacter woesei: Cwoe_5075Help
Entry
Cwoe_5075         CDS       T01153                                 

Definition
(GenBank) transcriptional regulator, GntR family
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR MarR_2 HTH_Crp_2 HTH_28 Fe_dep_repress HTH_29 TrmB
Motif
Other DBs
NCBI-ProteinID: ADB53484
UniProt: D3FD92
Position
complement(5423743..5424429)
Genome map
AA seq 228 aa AA seqDB search
MADSLIDDDGAWEEPTSRAQDVAQQLRELIFDGELRAGSPIRQEAVARRLGVGRFPVREA
LRLLESEGLVVLRPNSGARVALLDFAECEEIYKMRERLEPLAFAESVGRLTPEQIERAHT
LSAALPGLVHDPKRWLEGDRRLHLACYAGIPTPRLLRTIVSYWNISQQYRRVLLTTFTER
DFELQHAEHELIIDALESDNSRAGEDLMRAHIERSRLRLTRHRHLFEE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggccgattcactgatcgacgacgacggggcgtgggaggagccgacctcgcgcgcgcag
gacgtcgcgcagcagctgcgtgagctgatattcgacggcgagctgcgggccggctcgccg
atccgccaggaggcggtcgcgagacggctcggcgtcggccgcttcccggtgcgggaggcg
ctgcggctgctggagagcgaaggcctcgtcgtgctgcggcccaacagcggcgcgagagtc
gcgctgctcgacttcgccgagtgcgaggagatctacaagatgcgcgagcggctggagccg
ctcgcgttcgccgaaagcgtcggccggctgacgcccgagcagatcgagcgcgcgcacacg
ctctcggccgcgctgccgggcctggtgcacgaccccaagcggtggcttgagggcgaccgg
cgcctgcacctcgcctgctacgcggggatcccgacgccgcggctgctgcgcacgatcgtc
agctactggaacatcagccagcagtaccggcgggtgctgctgacgacgttcaccgagcgt
gacttcgagctgcagcacgctgagcacgagctgatcatcgacgcgctcgagagcgacaac
tcgcgcgcgggcgaggacctgatgcgcgcccacatcgagcgcagccgcctgcgcctcacg
cgccaccggcatctgttcgaggagtga

DBGET integrated database retrieval system