KEGG   Conexibacter woesei: Cwoe_5087Help
Entry
Cwoe_5087         CDS       T01153                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02033  peptide/nickel transport system permease protein
Organism
cwo  Conexibacter woesei
Pathway
cwo02024  Quorum sensing
Module
cwo_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Cwoe_5087
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cwo02000]
    Cwoe_5087
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Cwoe_5087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADB53496
UniProt: D3FDA4
Position
complement(5437648..5438580)
Genome map
AA seq 310 aa AA seqDB search
MSRYLAGRVLEMVPVVVCLSFAAFMLIHLVPGDPATAKLGIRGTPEQIAAFRAQLGLDQS
LPQQYWHFISGALTFDFGESIRSQEDVGELIGRRLQPSFLLVGYALLIAIVVAVPLATIA
AVRRRSWVDQLIRLLSTVGFVMPSFWLALLLVNLFSVQLGVFPTSGYGDTFSEHLRSLTL
PALTIGLGLAPLLLRLLRDSEIETLQSEYVGAARARGLSEPRVLAKHVLRNSATSTVTLL
GVLAGVLLSATVIVEQIFAIPGLGSLLVTSVRFRDYPVVQALTLLFGIVVVVAGLLADLV
YAYLDPRVRL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgatatctcgccggccgggtcctcgagatggtcccggtcgtcgtctgcctcagc
ttcgccgcgttcatgctgatccacctggtgccgggcgaccccgcgactgccaagctcggc
attcgcgggacgcccgagcagatcgcggcgttccgtgcccagctcgggctcgaccagtcg
ctgccgcagcagtactggcacttcatcagcggcgcgctgacgttcgacttcggcgagtcg
atccgctcgcaggaggacgtcggcgagctgatcggccggcgcctgcagccgagcttcctg
ctcgtcggctacgcgctgctgatcgcgatcgtcgtcgccgtgccgctggcgacgatcgcc
gcggtgcggcggcgcagctgggtcgaccagctgatccgcctgctgtcgacggtcggcttc
gtgatgccgtcgttctggctcgcgctgctgctcgtcaacctcttcagcgtgcagctcggc
gtcttcccgacgtcgggctacggcgacacgttctccgagcacctgcgcagcttgacgctg
cccgcgctgacgatcgggctcgggctcgcgccgctgctgctgcggctgctgcgcgacagc
gagatcgagacgctgcagagcgagtacgtcggcgcggcgcgggcgcgcggcctgagcgag
ccgcgggtcctcgccaagcacgtgctgcgcaactcggcgacctcgaccgtcacgctcctc
ggcgtactcgctggcgtgctgctgagcgcgacggtgatcgtcgagcagatcttcgcgatc
cccggcctcggttctctgctggtcacgtccgtcagattccgcgactaccccgtcgtgcag
gcgctgacgctgctgttcgggatcgtcgtcgtggtcgccggcctgctcgccgacctcgtc
tacgcctacctcgacccgcgggtgcggctgtga

DBGET integrated database retrieval system