KEGG   Conexibacter woesei: Cwoe_5095Help
Entry
Cwoe_5095         CDS       T01153                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02026  multiple sugar transport system permease protein
Organism
cwo  Conexibacter woesei
Module
cwo_M00207  Putative multiple sugar transport system
Brite
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    Cwoe_5095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Bax1-I
Motif
Other DBs
NCBI-ProteinID: ADB53504
UniProt: D3FDB2
Position
complement(5450143..5450964)
Genome map
AA seq 273 aa AA seqDB search
MSEHPIAERAGRLLLYLAVALVNLPVLVVVLNAFKNEADMASHELLPSGLTLDNFEIVRD
SSLGTWMVNSFVVAGCGTLIAVTAAIFGGYALSRFRQRGLEGWSRLLLAVQMVPIVLTLL
PLFLVMRRFALIDSYLGLIIIYGAFLLPFSTWIARSFFDSIPVDLEEAAWMDGCSRVQTL
VRVVAPLAAPGLVSIGILCFITAWNEYLLASVFLRSNELLTVGVGLQLFSAQLTTQVGPV
MAGATVAMIPSLLVYLVFQRYFVSGALAGAVKG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcatccgatcgccgaacgcgccggccggctgctgctgtacctcgcggtcgcg
ctggtcaacctgccggtcctcgtcgtcgtgctgaacgcgttcaagaacgaggccgacatg
gcctcccacgagctgctgccgtccgggctgacgctcgacaacttcgagatcgtgcgcgac
tcgtcgctcggcacctggatggtcaacagcttcgtcgtcgccggctgcggaacgctgatc
gccgtcacggcggcgatcttcggcggctacgcgctgtcgcgcttcagacagcgcggcctg
gagggctggtcgcggctgctgctcgccgtccagatggtgccgatcgtgctgacgctgctg
ccgctcttcctcgtgatgagacggttcgcgctgatcgactcctacctcgggctgatcatc
atctacggcgcgttcctgctgccgttctcgacctggatcgcgcgcagcttcttcgactcg
atcccggtcgacctggaggaggcggcgtggatggacggctgctcgcgcgtgcagacgctc
gtgcgcgtcgtcgcaccgctggccgcgccgggcctcgtcagcatcgggatcctctgcttc
atcaccgcgtggaacgagtacctgctcgcgagcgtcttcctgcgctccaacgagctgctg
accgtcggcgtcgggctgcagctgttcagcgcgcagctgacgacgcaggtcggccccgtg
atggccggcgcgacggtcgcgatgatcccgtcgctgctcgtctacctggtgttccagcgc
tacttcgtcagcggcgcgctcgcgggcgcggtgaaagggtga

DBGET integrated database retrieval system