KEGG   Conexibacter woesei: Cwoe_5097Help
Entry
Cwoe_5097         CDS       T01153                                 

Definition
(GenBank) extracellular solute-binding protein family 1
  KO
K02027  multiple sugar transport system substrate-binding protein
Organism
cwo  Conexibacter woesei
Module
cwo_M00207  Putative multiple sugar transport system
Brite
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    Cwoe_5097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_1 SBP_bac_8 TAT_signal
Motif
Other DBs
NCBI-ProteinID: ADB53506
UniProt: D3FDB4
Position
complement(5451830..5453164)
Genome map
AA seq 444 aa AA seqDB search
MRQTHPARGSLALSTPLSRRSLLKAAGAAGAALTGAPLLAACGSSGGGGGSGGAATIEFW
DMLWGLDRYEPTARALVAEWNRANPDLQVKYRLIPWASFYEVFSTAVASGTTPDVSTGAT
YQAFQFEQAIEPMNDAVAQWRRDGTYDQVIPQSITAQATEDGEQTGLPWGMTLRTLSCNR
KLFGAAGVTQPRSFDELRAAARRLTGGGRYGMGFCGQGALGWQMLLSLMVNNGGGLYDAK
CGPALVTDRNREACQLVQDMVRDGSIPKAAVGWDQTDVSAAMTRGDIAMAITEPALFNSL
PNGADIDIASPYEGFHGDKGTLLWYLAMWQYRTSEDKPGATEFMNWWLSNEQPLWSRGGT
TQLPVRTPFYDEIRTLQDPRYRKVLDEWVPVGKIMSTPCEYALPTLNQVEGQAFMPTLVQ
DVLSLKPIDESLQTAQDALSQLRA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagacccatcccgcgcggggatcgctcgcgctgagcacaccgctgtcgcgccgc
agcctgctgaaggcggccggagcggccggcgccgcgctgaccggcgcgccgctgctggcg
gcgtgcggctcctccggcggaggcggcggctccggcggcgcggcgacgatcgagttctgg
gacatgctgtggggcctcgacagatacgagccgacggcgcgcgcgctcgtcgccgagtgg
aacagagcgaaccccgacctccaggtcaagtaccgcctgatcccgtgggcgagcttctac
gaggtcttctcgaccgccgtcgccagcggcaccacgccggacgtcagcaccggcgcgacc
tatcaggcgttccagttcgagcaggcgatcgagccgatgaacgacgccgtcgcgcagtgg
agaagagacggcacctacgaccaggtgatcccgcagtcgatcacggcgcaggcgacggag
gacggcgagcagacgggcctgccctgggggatgacgctgcgcacgctcagctgcaacaga
aagctgttcggtgccgcgggtgtgacacagccgagatcgttcgacgagctgcgcgccgcc
gccagaagactgaccggcggcgggcgctacgggatgggcttctgcggccagggcgcgctc
ggctggcagatgctgctgtcgctgatggtcaacaacggcggcggcctctacgacgcgaag
tgcgggccggcgctggtgaccgatcgcaaccgcgaggcgtgccagctcgtgcaggacatg
gtccgcgacggctcgatcccgaaggccgcggtcggctgggaccagaccgacgtctcggcc
gcgatgacgcgcggcgacatcgcgatggcgataaccgagccggcgctgttcaactcgttg
cccaacggcgccgacatcgacatcgcctcgccgtacgagggcttccacggcgacaagggc
acgctcctctggtacctcgcgatgtggcagtaccgcaccagcgaggacaagcccggggcg
accgagttcatgaactggtggctgagcaacgagcagccgctgtggtccagaggcggcacg
acgcagctgccggtgcgcacgccgttctacgacgagatcagaacgctgcaggacccgcgc
tacagaaaggtgctcgacgagtgggtgccggtcggcaagatcatgtcgacgccctgcgag
tacgccctgccgacgctcaaccaggtcgaggggcaggcgttcatgccgacgctcgtgcag
gacgtcctgtcgctgaagccgatcgacgaatcgctgcagaccgcgcaggacgcgctgtcg
cagctgagagcgtga

DBGET integrated database retrieval system