KEGG   Conexibacter woesei: Cwoe_5100Help
Entry
Cwoe_5100         CDS       T01153                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: ADB53509
UniProt: D3FDB7
Position
5456782..5458035
Genome map
AA seq 417 aa AA seqDB search
MTNPYGELFKTPGALAFSAAGFVARMPISMIGIGLITMLSQEHGGFGTAGAIAATFTLST
ALLGPLVSRLVDRFGQGRVLLPAAGISVIALGALLLCARWGAPTWTLFVFAALAGTLPNM
SAMVRARWAHAQRGSSRLHTAFSLESVVDELTFVVGPALAVTLSTSLFAEAGPLVAAALL
TIGVLLFVPQKRTEPPIVRDAAARAGTSAIRIGALRPLALMLLAGGTIVGTIDVVSIAFA
EQQGSTASAGIVVALYAVGSGLAGLAFGVLRPTVPQPLLLVLGAAGTALTTLPLLVVDGI
AALAATVFVAGLFFAPTMIVTMGLVERIVPAGQLTEGMTWVIAGLLVGVALGASVSGAIV
DAHGPIGGFVVAIAAGAAMLLIALASCRPLLRATGAGDAAEHVGATGRVAQACAGDQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacccgtacggcgagctgttcaagaccccaggcgcactcgccttctccgccgcg
ggcttcgtcgcgcgcatgccgatctcgatgatcggcatcgggctgatcacgatgctgtcc
caggagcacggcgggttcggcacggccggcgcgatcgccgcgacgttcacgctctcgacg
gcactgctcgggccgctcgtctcgcggctcgtcgaccgcttcgggcagggaagggtgctg
ctgccggccgcgggcatcagcgtgatcgcgctcggcgctctgctgctgtgcgcccgctgg
ggcgcgccgacgtggacgctgttcgtcttcgccgcgctcgccggcacgctgccgaacatg
tccgcgatggtgcgcgcgcgctgggcgcacgcgcagcgcggctcctcgcgactgcacacc
gccttctcgctggagtcggtcgtcgacgagctgaccttcgtcgtcggtccggcgctggcc
gtcacgctgtcgacctcgctgttcgccgaggcggggccgctcgtcgccgccgcgctgctg
acgatcggcgtgctgcttttcgtgccgcagaagcggaccgagccgccgatcgtgcgggat
gcagccgcgcgggccggcacctccgcgatccggatcggcgcgctgcggccgctcgcgctg
atgctgctcgccggcggcacgatcgtcggcacgatcgacgtcgtcagcatcgcgttcgcc
gagcagcagggcagcaccgccagcgccgggatcgtcgtcgcgctctacgcggtcggctcc
ggtctcgccggactggcgttcggagtgctcagaccgaccgtgccgcagccgctgctgctc
gtgctcggcgccgcgggcaccgcgctgacgacgctgccgctgctcgtcgtcgacggcatc
gcagcgctcgccgcgacggtcttcgtcgccggcctcttcttcgcgccgacgatgatcgtg
acgatgggcctcgtcgagcggatcgtgcccgccggccagctgaccgagggcatgacatgg
gtgatcgccggcctcctcgtcggcgtcgcgctcggcgcgagcgtctccggcgcgatcgtc
gacgcgcacggcccgatcggcggcttcgtcgtcgcgatcgccgccggcgcggcgatgctg
ctcatcgcgctcgcgagctgccggccgctgctgcgcgcgaccggcgccggtgacgccgcc
gagcacgtcggcgcgacgggtagggtggcgcaggcctgcgcgggcgaccagtga

DBGET integrated database retrieval system