KEGG   Conexibacter woesei: Cwoe_5102Help
Entry
Cwoe_5102         CDS       T01153                                 

Definition
(GenBank) transcriptional regulator, IclR family
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR HTH_24 HTH_20 MarR_2 DprA_WH Rrf2 HTH_11 HTH_47 HTH_27 TrmB HTH_Mga MarR
Motif
Other DBs
NCBI-ProteinID: ADB53511
UniProt: D3FDB9
Position
complement(5458635..5459441)
Genome map
AA seq 268 aa AA seqDB search
MSENGHRSRATRSKAPAADRTLTILELLTESERPLSLTEIATRADVPLASCSAIMRTLEA
RGYAVEHVSGRTHHWQPTLAIYKLGARLIVRLGLAESSQPHIEQLADELGMPASAGVLEN
DHVIYLAKAAGPSFVQFHTFVGRAVPFGTTAIGKAIAAFLPVERRIALVGSGRGSRRALA
ELEESSRLGYAIEDEEEYEGIACAAAPVFDATGRCCGGISVTGFRADVLGDARRERTITA
VRTSAAAISAEMGAPERQLALLRTPVVL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacggacacagaagcagagcgacgagatcgaaggctccggccgccgatcgc
acgttgacgattctcgagctgctgaccgagtccgagcggccgctttcgctgaccgagatc
gcgacccgggccgacgtcccgctggcgagctgctcggcgatcatgcgcacgctggaggcg
cgcggctacgccgtcgagcacgtcagcggacgcacccaccactggcagccgacgctggcg
atctacaagctcggcgcgcgcttgatcgtgcggctcggcctcgccgagagctcccagccg
cacatcgagcagctcgccgacgagctggggatgccagcgagcgccggggtgctcgagaac
gaccacgtgatctacctcgcgaaggcggccgggccgtcgttcgtccagttccacacgttt
gtcgggcgcgcggtgccgttcggcacgaccgcgatcggcaaggcgatcgcggcgttcctg
ccggtcgagcggcggatcgccctcgtcggcagcggccgcggatcgcgcagagcgctcgcg
gagctggaggagagctcgcggctcggctacgcgatcgaggacgaggaggagtacgagggg
atcgcgtgcgcggcggcgccggttttcgacgcgaccggtcgctgctgcggcgggatctcg
gtcactggcttccgcgccgacgtgctcggcgacgcgcggcgcgaacggacgatcacggcg
gtccgcacgagcgccgccgcgatctccgccgagatgggcgcgcccgagcgtcagctcgcg
ctgctgcgcacgcccgtcgtgttgtga

DBGET integrated database retrieval system