KEGG   Conexibacter woesei: Cwoe_5119Help
Entry
Cwoe_5119         CDS       T01153                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N DUF485
Motif
Other DBs
NCBI-ProteinID: ADB53528
UniProt: D3FDD6
Position
complement(5474835..5475716)
Genome map
AA seq 293 aa AA seqDB search
MSATVAMEAAAEHAHGGRAGVLRRLARRRAAVVSAAAIALLLLLSLLATPIAGSPTAIDT
NQILAAPSGAHLLGTDELGRDLLARTFAGGRITLLVAFGAMAVSMLLGIVWGFVAAASGR
AVDETLMRVADAGMAIPAILLALILVAAFGSSTWTLAIVSGVLLAPQTARIARSALLAEL
RSDYRLAARATGVSPLRTVFGELLPNASPALIAQASLNIAWAIGIEASLSFLGLGVQPPD
ASWGTLLQEGYASLYRSVWLTVVPAVAIFVAILAFNTLGTQLQHVLDPREEER
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccactgttgcgatggaggctgccgccgagcacgcgcacggcgggcgcgccggc
gtgctgcgccggctcgcgcgacggcgcgccgccgtcgtctccgcggcggcgatcgcgctg
ctgctcctgctgtcgctgctggcgacgccgatcgccggctccccgacggcgatcgacacg
aaccagatcctcgccgcgccgtcgggcgcccacctgctcgggaccgacgagctcggccgc
gacctgctcgcgcgcacgttcgccggcgggcgcatcacgctgctcgtcgcgttcggcgcg
atggccgtctcgatgctgctcgggatcgtctggggcttcgtggcggcggcgagcggacgg
gccgtcgacgagacgctgatgcgcgtcgccgacgccgggatggcgatcccggcgatcctg
ctcgcgctgatcctcgtcgccgcgttcggctccagcacctggacgctcgcgatcgtcagc
ggcgtgctgctcgcgccgcagacggcgcgcatcgcgcgctcggcgctgctggcggagctg
cgctcggactaccgtctcgccgcgcgcgcgaccggcgtctcgccgctgcgcaccgtcttc
ggcgagctgctgccgaacgcgtcgccggcgctgatcgcgcaggcgtcgctgaacatcgcg
tgggcgatcgggatcgaggcaagcctctcgttcctcggcctcggcgtgcagccgcccgac
gcctcgtgggggacgctcctgcaggagggctacgccagcctctaccgctcggtctggctg
accgtcgtcccggctgtcgcgatcttcgtcgcgatcctcgccttcaacacgctcggcacg
cagctgcagcacgtgctcgacccccgagaggaggagcgatga

DBGET integrated database retrieval system