KEGG   Conexibacter woesei: Cwoe_5124Help
Entry
Cwoe_5124         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_U32
Motif
Other DBs
NCBI-ProteinID: ADB53533
UniProt: D3FDE1
Position
5482997..5483998
Genome map
AA seq 333 aa AA seqDB search
MLPTRELLADIGLPASDAHHLPDSPQRFPDGGQWRLEIPSTEGPESLREVLAAGDERGLR
VHRVSQGSGIMLQTDAEIREMVELGAARDVEVSLFVGPRAAWDVGVQATTDSGRLAGMSL
RGADQLGYALDDVARACELGLRSVLVSDLGLLSVLGQLRARGDLPSDLVLKVSVSLPAAN
PATARVLQELGATTINLPVDLTLAQLAAIRAAVDVPLDLYIETTDDFGGLLRYHEIPEIV
RVAAPVYLKFAVRNSPGLYPAGGHLRDAALATARERVRRAAIGLELLARNAPGAVMSETT
GYGTTLGALATPAAAGAAGSPAFEASAAADGAA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctccccacccgtgaactgctcgccgacatcggcctgccggcgtccgacgcccatcac
ctgcccgactcaccgcagcgcttccccgacggcggccagtggcggctggagataccgtcg
accgaggggccggagtcgctgcgcgaggtgctcgcagccggcgacgagcgcgggctgcgg
gtccatcgcgtcagccagggcagcgggatcatgctccagaccgacgccgagattcgcgag
atggtggagctgggcgccgcgcgcgacgtcgaggtctcgctgttcgtcggcccgcgcgcc
gcgtgggacgtcggcgtgcaggcgacgaccgactccggccggctcgccggcatgtcgctg
cgcggcgccgaccagctcggctacgcgctcgacgacgtcgcccgcgcctgcgagctcggc
ctgcgcagcgtgctcgtctccgacctcgggctgctgagcgtgctcggccagctgcgcgcg
cgcggcgacctgccctccgacctcgtgctgaaggtctccgtctcgctgccggccgccaac
ccggcgacggcccgcgtgctgcaggagctgggcgcgacgacgatcaacttgcccgtcgac
ctgacgctcgcgcagctcgcggcgatccgcgccgccgtagacgtgccgctcgacctctac
atcgagacgaccgacgacttcggcggcctgctgcgctaccacgagatccccgagatcgtg
cgcgtcgcagcgccggtctacctgaagttcgcggtccgcaactcgcccggcctctacccc
gccggcggccacctgcgcgacgccgcgctcgcgacagcgcgcgagcgcgtgcggcgcgcc
gcgatcggcctggagctgctcgcgcgcaacgcgcccggcgccgtcatgagcgagacgacc
ggctacggcacgacgctcggcgcgctggcgacgccggcggccgcgggcgccgcgggctca
ccggcgttcgaggcgtccgccgccgcggacggcgcggcatga

DBGET integrated database retrieval system