KEGG   Conexibacter woesei: Cwoe_5134Help
Entry
Cwoe_5134         CDS       T01153                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 Epimerase NmrA RmlD_sub_bind GDP_Man_Dehyd 3Beta_HSD adh_short TrkA_N Sacchrp_dh_NADP adh_short_C2 AlaDh_PNT_C ADH_zinc_N NAD_binding_4 DapB_N KR
Motif
Other DBs
NCBI-ProteinID: ADB53543
UniProt: D3FDF1
Position
complement(5494868..5495743)
Genome map
AA seq 291 aa AA seqDB search
MNKIIITGSTGVIGRRAVRELLAAGHDVSGVTRSARGRELLESLGARAVEADVYDEASLR
RVFDGADTVVNLLTSIPSADRMGDPSAWAENDRIRTDASAAIARAAQAAGVRRLVQESIA
FVYADGGDAWLDEDAPVVGGGVTTSALTAERNARELFDGDTVVLRFGMFMGADSGSTLAT
LEAARGGASFAFGPPGAYRPTVLLDDAGTAVAAALRVPAGTYNVADADPATYGEIDAALA
AVVGVDALHGQPPEDGPLARSQRVSTRRLREASGWAPRMRAATEIWSGLAA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatcatcatcaccggatccacaggcgtcatcgggcgccgcgccgtccgcgag
ctgctcgccgccggccacgacgtcagcggcgtgacgcgctccgcacgcgggcgcgagctg
ctcgagagcctcggtgcgcgcgccgtcgaggccgacgtgtacgacgaggcgtcgctgcgc
cgcgtcttcgacggcgcggacaccgtcgtcaacctgctcacgagcatcccgagcgccgat
cgcatgggcgacccgtcggcgtgggcggagaacgaccgcatccgcaccgacgcgtcggcg
gcgatcgcgcgcgccgcgcaggccgccggggtccgacggctcgtgcaggagtcgatcgcg
ttcgtgtacgccgacggcggcgacgcgtggctcgacgaggacgcgccggtcgtcggcggc
ggcgtcacgacgagcgcgctgacggccgagcgcaacgcgcgcgagctgttcgacggcgac
accgtcgtgctgcgcttcgggatgttcatgggagccgacagcgggtccacgctggcgacg
ctggaggccgcgcgcggcggcgcctcgttcgcgttcggaccgcccggcgcgtaccggccg
accgtcttgctggacgacgccgggacggccgtcgccgcggcgctgcgcgtcccggccggg
acctacaacgtcgccgacgccgacccggcgacgtacggcgagatcgacgccgcgctggcg
gcggtcgtcggggtcgacgcgctgcacggccagccgccggaggacgggccgctggcgcgc
tcgcagcgcgtgtcgacccgtcggctgcgcgaggcgagcggttgggcgccgcggatgcgc
gcggccacggagatctggagcggactcgccgcatga

DBGET integrated database retrieval system