KEGG   Conexibacter woesei: Cwoe_5155Help
Entry
Cwoe_5155         CDS       T01153                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
cwo  Conexibacter woesei
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cwo03021]
    Cwoe_5155
Transcription machinery [BR:cwo03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Cwoe_5155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 SnoaL_2 DUF4440 SnoaL_3 Lumazine_bd_2
Motif
Other DBs
NCBI-ProteinID: ADB53564
UniProt: D3FE72
Position
complement(5513868..5514890)
Genome map
AA seq 340 aa AA seqDB search
MDDKELEELRRHGFGIAYRMLGSVSEAEDVAQEALLRLTRHEDSIDEPAAWMTTVATRLA
INVLKSARARRESYVGPWLPEPLVEDPAPDPASRAELEDSLSLALLVLLERLTPVERAAY
LLREVFGYGYAEIAAVIEQTEVNSRQLVTRARKHIDASRPRFDADEVARDTLLERFLAAA
EEGDLEALEQLLAKDAALYADGGGKAMAAPEPLFGAAPIARFMAAVAHGRSASGELESRR
VRVNGQPGRVVRGPAERELGEAERLAAENVLALVLSGDGDATQLAALVQSARGAVGGQTD
RAVSRQQADVRVTSVLTVDVVDGRIQTVRVVRNPDKLAHL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaaggaactcgaggagctgcgccggcacgggttcggcatcgcctaccggatg
ctcggcagcgtctcggaggccgaggacgtggcgcaggaggcgcttctgcgcctgacgcgg
cacgaggattcgatcgacgagccggcggcttggatgacgacggtggcgacgcggctcgcg
atcaacgttctgaagtcggcgcgggctcgtcgcgagtcgtatgtcgggccgtggctgcca
gagccgctggtcgaggatccggcacccgacccggcgtcgcgcgccgagctggaggattcg
ctgtcgctggcgctgctggtgctgctggagcggctgaccccggtcgagcgagcggcgtat
ctgctgcgtgaggtgttcggctacgggtatgcggagatcgccgccgtcatcgagcagacc
gaagtgaactcgcggcagctcgtgacgcgggcgcggaagcacatcgatgccagccgcccg
cgcttcgacgccgacgaggtcgcccgcgacacgttgctcgaacggtttctcgcggccgcc
gaggagggcgacctggaggccttggagcagctgctggcgaaggacgccgctctgtacgcc
gacggcggcggcaaggcgatggcggcgccggagccgctcttcggcgccgcgccgatcgcg
cgcttcatggccgccgtggcacacggacgctctgcttccggcgagctcgagagccgacgg
gtgagggtcaacggccagcctggtcgcgtggtgcgaggcccggcagagcgggagctcggc
gaggccgagcggctcgcggccgagaacgtgctggcgctcgtactgtccggggacggtgac
gcgacgcagctcgccgcgctcgtgcagagcgcccgaggcgccgtcggaggccagacggat
cgggccgtttcccggcagcaggctgacgtgcgagtcacgagcgtgctcacggtggatgtc
gtcgacggccggatccagacggtgcgcgtcgtgcgcaaccccgacaagctcgcccatctc
tga

DBGET integrated database retrieval system