KEGG   Conexibacter woesei: Cwoe_5291Help
Entry
Cwoe_5291         CDS       T01153                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cwo  Conexibacter woesei
Pathway
cwo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cwoe_5291
DNA repair and recombination proteins [BR:cwo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Cwoe_5291
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cwoe_5291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim IMS_HHH HHH_5
Motif
Other DBs
NCBI-ProteinID: ADB53697
UniProt: D3FFA4
Position
complement(5653184..5653822)
Genome map
AA seq 212 aa AA seqDB search
MSSFAPPVQRLITELGRLPGIGGRTAQRLAFHLLRASEEDALALAEAIKEVKARIGLCEV
CFNLSDGPRCRICSDERRDAGLVCVVEEPSDIIPIERTHEFHGRYHVLGGALSPIDGIDP
EDLRIAELYTRVTPPADAPQDEHPTPIREVVLATNPTTTGEATALHIAAHLREQAPQVTV
TRLASGLPVGADLEYADELTLGRALSGRRALS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgttcgcgccacccgtccagcggctgatcaccgagctcggcagactgcccggc
atcggcggccgcacggcgcagcgactcgccttccacctgctgcgggcctccgaggaggac
gcgctcgcactcgccgaggcgatcaaggaggtcaaggcgcggatcgggctgtgcgaggtc
tgcttcaacctctccgacgggccgcgctgccgcatctgctctgacgagcgccgcgacgcc
ggcctcgtctgcgtcgtcgaggagccgtcggacatcatcccgatcgagcgtacgcacgag
ttccacgggcgctaccacgtgctcggcggcgcgctctcgccgatcgacgggatcgacccc
gaggacttgcggatcgcggagctgtacacgcgcgtgacgccgcccgccgacgcgcctcag
gacgagcatccgacgccgatccgcgaggtcgtgctcgcgacgaacccgaccacgacgggc
gaggcgaccgcgctgcacatcgccgcccacctgcgcgagcaggcgccgcaggtgaccgtc
acgcgcctcgcgagcggcctgccggtcggcgccgacctcgagtacgccgacgagctgacg
ctcggccgcgcgctctcgggccgccgcgccctctcctga

DBGET integrated database retrieval system