KEGG   Conexibacter woesei: Cwoe_5641Help
Entry
Cwoe_5641         CDS       T01153                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cwo  Conexibacter woesei
Pathway
cwo00010  Glycolysis / Gluconeogenesis
cwo00052  Galactose metabolism
cwo00500  Starch and sucrose metabolism
cwo00520  Amino sugar and nucleotide sugar metabolism
cwo00521  Streptomycin biosynthesis
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cwoe_5641
   00052 Galactose metabolism
    Cwoe_5641
   00500 Starch and sucrose metabolism
    Cwoe_5641
   00520 Amino sugar and nucleotide sugar metabolism
    Cwoe_5641
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cwoe_5641
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cwoe_5641
Enzymes [BR:cwo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cwoe_5641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADB54045
UniProt: D3F0W1
Position
6041959..6042906
Genome map
AA seq 315 aa AA seqDB search
MSAVVALDVGGTGLKGAVVDRSGRLLCAERRATPRDEGPQAIAEAALTFAGDLAAGGPAR
DAGGTVHVALAVPGLVDDTAGWVRLAPNLGWSDLPLRTLVEERLDLPALVWHDARAAALA
EGMLGAARGARDWLLVTIGTGIGGAVIADGRALHGTRGAAGELGHIGVAPDGPLCACGKR
GCVEALASGRNLSVRYAELTGEADVAAEQIVARAERGDVSAQLVWETAVGALAAGLAGCA
ALLDPELIVLGGGVASAGDRLRDPLARRLATEVRFPPAPPLRTAALGERAGWIGAALAGW
QAAGAEPGEVARWTL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggtcgtcgcgctcgacgtcggcgggacggggctgaagggagcggtcgtcgac
cgctccggccgcctgctgtgcgccgagcggcgcgcgacgccgcgcgacgaggggccgcag
gcgatcgccgaggccgcgctcacgttcgccggcgacctggccgccggcggtcccgcgcgc
gacgccggcggcaccgtccatgtcgccctcgccgtgcccgggctcgtcgacgacacggcc
ggctgggtgcggctcgcgccgaacctcggctggagcgacctcccgctgcgcacgctcgtc
gaggagcggctcgacctgcccgcgctcgtctggcacgacgcgcgcgcggccgcgctcgcc
gaaggaatgctcggcgcggcgcgcggtgcgagagactggctgctggtgacgatcgggacc
ggcatcggcggcgcggtgatcgcggacggacgggcgctgcacggcacgcgcggcgcggcc
ggcgagctgggccacatcggcgtcgcacccgacggcccgctgtgcgcgtgcggcaagcgc
ggctgcgtcgaagcgctcgcctccggccgcaacctcagcgtgcgctacgccgagctgacc
ggcgaggcggacgtcgcggcggagcagatcgtcgcgcgcgccgagcgcggcgacgtgtcc
gctcagctcgtctgggagacggccgtcggcgcgctcgcagccgggctcgcgggctgcgcc
gcactgctcgatcccgagctgatcgtgctcggcggtggcgtcgcgtcggccggcgaccgc
ctgcgcgacccgctcgcgcgccggctcgcgacggaggtccgcttcccgcccgcgccgccg
ctgcgaacggcggcgctcggcgagcgcgccggctggatcggcgccgcgctcgccggctgg
caggcggccggcgccgagcccggggaggtggcgcggtggacgctgtga

DBGET integrated database retrieval system