KEGG   Synechococcus sp. JA-3-3Ab: CYA_0477
Entry
CYA_0477          CDS       T00318                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00620  Pyruvate metabolism
cya00640  Propanoate metabolism
cya00650  Butanoate metabolism
cya01100  Metabolic pathways
cya01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYA_0477 (pflB)
   00640 Propanoate metabolism
    CYA_0477 (pflB)
   00650 Butanoate metabolism
    CYA_0477 (pflB)
Enzymes [BR:cya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CYA_0477 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 FmdE
Other DBs
NCBI-ProteinID: ABC98695
CyanoBase: CYA_0477
CYORF: CYA_0477
UniProt: Q2JQS8
Position
complement(493749..496055)
AA seq 768 aa
MIASAQRSVALSTESKAQKTTERKVSDQTIGRDFLPGRWQRCIDVRDFIQRNYTPYTGDE
SFLAPASERTQRLWAKVKDLMALERERGVLDADTDLPSSITSHPPGYIDRELEQIVGLQT
DKPLKRAIMPFGGIRMVETALKAYGYELDPKVKEIFTKYRKTHNDGVFDAYTEEMRRCRR
SGIITGLPDAYGRGRIIGDYRRVPLYGVDRLIEDKEAQKASLEVDTMDEETIRLREELSE
QIKALYELKEMGASYGFDLGRPASNAREAIQWLYLAYLAAVKEQNGAAMSLGRVSTFLDI
YIERDLQAGILTEEEAQELIDHFVMKLRMVRFLRTPEYNELFSGDPTWVTECIGGMGLDG
RPLVTKTSFRMLHTLYNLGPAPEPNLTVLWSERLPEAFKRYCAKVSIETSSIQYENDDLM
RPYWGDDYGIACCVSAMRIGKQMQFFGARVNLAKCLLYAINGGRDEISGEQVAPAYAPIT
SEVLEYDEVWPRLVQMMAWLAKTYVNTMNIIHYMHDKYCYERLEMALHDRDVLRTMAFGL
AGLSVTADSLSAIKYARVRAIRDERGLVVDYAVDGDFPKYGNNDDRVDSIAVQLVQTFMA
ELRKHKTYRNAIPTQSILTITSNVVYGKKTGNTPDGRRAGEPFAPGANPMHGRDTKGAVA
SLASVAKLPYDDALDGISNTFSIVPAALGRTAEERVANLVGLLDGYMRDGGFHLNVNVLN
RETLLQAMEHPELYPQLTIRVSGYAVNFIKLTREQQLDVINRTFHQHF
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgatagcaagcgcgcagcgttctgtagctttatctacagaatcgaaggcccaaaaaacc
acagaacgcaaagtatccgatcaaacgattgggagagattttctgccgggacggtggcaa
cgctgcattgatgtccgagattttattcagcgcaattacactccctacaccggcgacgaa
agcttcttggcgccggccagcgaacgcacgcagcggctgtgggccaaggttaaggatttg
atggcgctggagcgggagcggggggttttggatgccgacacggaccttccttccagcatc
accagccacccgccgggctatatcgaccgggagctggagcaaattgtaggcctacagacc
gacaagcccctgaagcgggccattatgccgttcggcggcatccgcatggtggagacggcc
ctcaaggcctacggctacgagctggatccaaaggttaaggaaatctttaccaagtaccgc
aagacccacaacgacggggttttcgacgcctacacggaggagatgcgccgctgccgccgc
tctggcatcatcaccggcttgccggacgcctatggacggggccgcatcatcggcgactac
cggcgggtacctctctatggcgtggatcggctgattgaggacaaggaggcgcagaaggcc
agcctagaggtggacacgatggatgaagaaaccatccgcctgcgggaggagctctcagag
cagatcaaagccctgtacgagctcaaggagatgggggccagctacggctttgacctgggc
cgtccggccagcaacgcccgcgaggccatccagtggctgtacctggcctacctggcagcc
gtcaaagagcaaaatggcgctgccatgtccctggggcgggtttccacgttcctagacatc
tacatcgagcgggatctgcaggccgggatcctcaccgaggaagaggcccaagagctcatc
gaccactttgtcatgaagctgcgcatggtcaggtttttgcgcacgccggagtacaacgag
ctctttagcggggatcccacctgggttaccgagtgcatcggcggcatggggctggatggg
cggcctctggttaccaagaccagcttccgcatgctgcataccctctacaacctggggccg
gcaccggagcccaacctgacggtgctctggtcggagcggctgccggaagccttcaagcgc
tactgcgccaaggtctccattgaaaccagctccatccagtacgaaaacgacgacttgatg
cgcccctactggggggatgactacggcatcgcctgctgtgtgtcggccatgcgcatcggc
aagcagatgcagttttttggagcgcgggtcaacctggccaagtgcctactctatgccatc
aatggcggccgggacgagatctccggcgagcaggtggccccggcctatgcccccattact
tctgaggtgctggagtatgacgaggtgtggccgcgcctggtgcagatgatggcctggctg
gccaagacctacgtcaacaccatgaacatcatccactacatgcacgacaagtactgctac
gagcgcctggagatggccctgcacgaccgggacgtgctgcgcaccatggcctttggcctg
gccggcctgtcggtaacagccgactccctatccgccatcaaatacgcgcgggtacgggcc
atccgggatgagcggggcctagtggtggattacgcggtggatggcgacttccccaaatac
ggcaacaacgatgaccgggttgactccattgcggtgcaactggtgcagaccttcatggcc
gagctgcgcaagcacaagacctaccgcaatgccatccccacccagtccatcctcaccatc
acctccaacgtggtctacggcaagaaaaccggcaacacccccgacgggcggcgagccggc
gagccctttgccccaggggccaaccccatgcacggccgggacaccaagggggcggtggcc
tcgctggcttcggtggccaagctgccctacgacgacgccctggatggcatctccaacacc
ttctcgattgtgccggcggccctaggtcgcaccgccgaggagcgggttgctaacctggtg
gggctgctggacggctacatgcgggatggcggctttcacctcaacgtcaacgtcctcaac
cgcgagaccctgctgcaggccatggagcaccccgagctctatccccagctcaccatccga
gtgtctggctacgcggtgaacttcatcaagctcacccgcgagcaacaactggatgtgatt
aaccgcaccttccaccaacacttctaa

DBGET integrated database retrieval system