KEGG   Synechococcus sp. JA-3-3Ab: CYA_0339Help
Entry
CYA_0339          CDS       T00318                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00260  Glycine, serine and threonine metabolism
cya00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
cya01130  Biosynthesis of antibiotics
cya01230  Biosynthesis of amino acids
Module
cya_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CYA_0339 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CYA_0339 (trpB)
Enzymes [BR:cya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CYA_0339 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: ABC98559
CyanoBase: CYA_0339
CYORF: CYA_0339
UniProt: Q2JXC7
Position
complement(357668..358867)
Genome map
AA seq 399 aa AA seqDB search
MRPDPRGRFGPFGGRFVPETLMSALTELEEAFEQHWRDPEFRAEFHSLLRDFVGRPSPLY
FAQRLTEHYDGPQIYLKREDLNHTGAHKINNALGQVLLAVRMGKRRIIAETGAGQHGVAT
ATVCARFGLECVIYMGAVDMERQAPNVQRMRLLGAEVRGVESGTATLKDALSEAIRDWVT
NVETTHYVIGTVAGPHPYPKLVRTFHDVIGQETRQQCQEKWGGLPDVLLACVGGGSNALG
LFNEFVRDPQVRLIGIEAAGEGLHTSRHAATLSRGRVGVLHGAMSYLLQDEEGQVQEAHS
ISAGLDYPGVGPEHSYLKAIGRAEYYAVTDDEAVEALLLLSRLEGIIPALETAHALAYLK
TLAPQLGPQQRVVVNCSGRGDKDLNTVFKYLQKRGHSLA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtccggatcctcggggccggtttgggccctttgggggccgttttgtgccggaaacc
ctgatgagcgccctgacggagctggaggaagcctttgagcagcattggcgggatcccgag
tttcgcgccgagttccacagcttgttgcgggattttgtcggtcggcccagccccctctac
tttgcccagcggctgaccgagcactacgacggcccccagatctacctcaagcgcgaagac
ctcaaccacaccggcgcccacaagatcaacaacgccctcggccaagtgctgctggcggtg
cgcatgggcaagcggcggatcatcgccgagactggcgctggccagcatggggtggccacg
gcaacggtgtgtgctcgttttgggttggaatgcgtcatctacatgggggcagtggacatg
gagcggcaggcccccaatgtgcagcggatgcgcctgctgggcgctgaggtaaggggggtc
gaatcaggcacagccaccctcaaagacgccctctccgaggccatccgcgactgggtaacc
aacgtggagaccacccactacgtcattggcacggtggccggaccccacccctacccgaag
ctggtgcggacctttcacgatgtcatcggccaggagacgcggcagcagtgtcaggagaaa
tggggagggctgccagacgtgttgctggcctgtgtgggcggcggctccaatgccctgggt
ctgttcaacgagtttgtccgcgatccccaggtgcggctcatcggcatcgaggctgccggg
gagggcttacacacctcccgccacgccgccaccctcagccgcggtcgcgttggggtcttg
cacggggccatgagctacctgctgcaagatgaagaaggccaggtgcaggaggcccattcc
atcagcgccggcttggattaccccggcgtggggccggagcacagctacttaaaagcaatt
gggcgagccgagtactacgccgttaccgacgacgaggcggtagaggcgctgctgctgctg
tcgcgcctggaggggatcatcccggctttggagacggcccatgccctggcctacctgaag
actttggccccccagcttggcccccagcagcgggtggtggtcaactgctccgggcggggc
gacaaggatctgaacaccgttttcaagtacttgcagaagcgggggcatagcctagcctag

DBGET integrated database retrieval system