KEGG   Synechococcus sp. JA-3-3Ab: CYA_1699Help
Entry
CYA_1699          CDS       T00318                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00030  Pentose phosphate pathway
cya00480  Glutathione metabolism
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
cya01120  Microbial metabolism in diverse environments
cya01130  Biosynthesis of antibiotics
cya01200  Carbon metabolism
Module
cya_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cya_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CYA_1699 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CYA_1699 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cya04147]
    CYA_1699 (zwf)
Enzymes [BR:cya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CYA_1699 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CYA_1699 (zwf)
Exosome [BR:cya04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CYA_1699 (zwf)
  Exosomal proteins of colorectal cancer cells
   CYA_1699 (zwf)
  Exosomal proteins of bladder cancer cells
   CYA_1699 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABC99855
CyanoBase: CYA_1699
CYORF: CYA_1699
UniProt: Q2JTX4
Position
1702907..1704457
Genome map
AA seq 516 aa AA seqDB search
MATLTENPLRVGLNQERIPDPCILVQFGASGDLAARKLIPAYYRLFVQRRLPPEFTLVGV
ARRDWSHEVYRDKMRAALEEFAPQDLGPEALWQDFASRLFYCRLDIGDAEGYLRLKQFLS
ELDEERGTRGNRVFYLAVAPDFYAQALQQLGAAGMLADPTRTRVVIEKPFGHDLTSAQEL
NRLVQRICQEEQVYRIDHYLGKETVQNLLVFRFANAIFEPLWNRNYIDHVQITVAETVGV
EDRAGYYDAAGALRDMVQNHLMQIYCLTAMEPPVSLRSDGVRNEKTKVLQATRLADTRNV
AAAAVRAQYGPGWIGGKPVPGYRQEPNVNPNSQTPTYVALKLECDTWRWQGVPFYLRTGK
RLAKKVSEVAIYFKQVPLSLFPSAAREVSPNILVLRIQPNEGISLRFEAKMPGPEIRTRS
VEMDFRYGTAFGSTTPDAYERLLLDCLLGDPTLFTRADEVEAAWRVVTPVLSAWEAQPGG
NGSSVAPPLYTYEAGTWGPKAAEDLLAQSGRRWRRL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccctgactgaaaaccccttgcgcgttggcctcaaccaagagcgcattccggat
ccttgtattttggtgcagtttggtgcttccggagatctggccgcccgcaagctgatcccg
gcctactaccggctattcgtgcagcgacggctgccgccggagtttaccctggtgggggtg
gcccggcgcgactggagccacgaggtctatcgggacaagatgcgggcggccctggaagaa
tttgccccccaagatctggggccagaagccctctggcaggacttcgccagccgcctgttt
tactgtcgcctggatattggcgatgccgagggctacctgcgcctcaagcaattcctcagc
gaattggacgaagagcggggcacccgcggcaaccgcgtgttttacctggcggtggcgccg
gacttctatgcccaggccctccagcagttgggggcagcggggatgctggcggatccaacc
aggacgcgggtggtgattgaaaagcccttcggccacgacctcacctcggcccaggagctg
aaccgccttgtgcagcgcatctgtcaggaagagcaggtctaccgcatcgaccactacctg
ggcaaagagacggtgcaaaacctgctggtctttcgctttgccaacgccatctttgagcct
ctctggaaccgcaactacatcgaccacgtgcagattacggtagcggaaacggtgggggtg
gaggaccgggccggctactacgacgctgccggcgctctgcgggacatggtgcaaaaccac
ctgatgcagatctattgcctgactgccatggagccgcccgtctccttgcgcagcgacggc
gtgcgcaacgaaaagactaaggtgctgcaggccacccgcctggcggacactcgcaatgta
gctgcggcagcagtgcgggcccagtacggccctggttggattggcggcaagccggtgcca
ggctatcgccaagagcccaatgttaaccccaactcgcaaacccccacctacgttgccctg
aaactggaatgcgacacctggcggtggcagggggtgcccttttacctgcgcaccggcaag
cgcctagccaagaaggtctccgaggtggccatctactttaagcaggtgccgctatctctt
tttccttcggcagcgcgggaggtgagccccaacatcctggtgctgcgcatacagcccaac
gagggcatctccttgcgctttgaggccaagatgccggggccggagatccgcacccgctcg
gtggaaatggattttcgctacgggacagcctttgggtcaaccacgccagatgcctacgag
cgcctactgttggactgcctgctgggggatcccaccctgttcacccgcgctgacgaggtg
gaagccgcctggcgggtggtgacgccggttttatcggcctgggaagcccagcccggcggc
aatggcagcagcgttgcgccgccgctgtacacctacgaagccggcacctgggggccgaag
gccgccgaagacctgctggcccagtcggggcggcggtggcgacgcctctag

DBGET integrated database retrieval system