KEGG   Synechococcus sp. JA-3-3Ab: CYA_2100Help
Entry
CYA_2100          CDS       T00318                                 

Definition
(GenBank) amidohydrolase, AtzE family
  KO
K01426  amidase [EC:3.5.1.4]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00330  Arginine and proline metabolism
cya00360  Phenylalanine metabolism
cya00380  Tryptophan metabolism
cya00627  Aminobenzoate degradation
cya00643  Styrene degradation
cya01100  Metabolic pathways
cya01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CYA_2100
   00360 Phenylalanine metabolism
    CYA_2100
   00380 Tryptophan metabolism
    CYA_2100
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CYA_2100
   00643 Styrene degradation
    CYA_2100
Enzymes [BR:cya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     CYA_2100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABD00240
CyanoBase: CYA_2100
CYORF: CYA_2100
UniProt: Q2JSX4
Position
complement(2117544..2118944)
Genome map
AA seq 466 aa AA seqDB search
MTGDPYLLGSADAVSIARAVRQGSVSAQAVVAACLERIRRRDPQLNAFTAVLEESALQAA
EQVDRQVAQGIPVGPLAGVPFAVKNLFDVAGLTTLAGSAINRENPPAIQDATVVARLKQA
GAILVGTLNMDEYAYGFVTENSHYGPTHNPHDLNRSAGGSSGGSAAAVAGGLVPLALGSD
TNGSIRVPASLCGVYGLKPTYGRLSRAGVALFAPSFDHVGPLARSVADIALSFDVMQGPD
PQDPVCTRRPVDPTFGQLGQGIEGLRIAVADDYFARGAELPILAGVEKVAQALGARQTVR
IPEAQRARAAAYLITAAEGANLHLPNLRTRPHDFDPATRDRFLAGALLPASWILQAQRFR
RWYRQQVQTIFQEIDLFIAPTTPCSAPLLGQEKMVIDGVEVLTRPNLGLYTQPLSFIGLP
VLSVPLRESGSLPFGVQLVAAPYQEAKLLRAAAYLEKLGIPDARPA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggatccctaccttctcggcagcgctgacgcggtctctattgccagggctgtc
cgccagggatccgtgagcgcccaagcggtggtggccgcctgtctggagcggattcgccgg
cgggatccccagctcaatgcctttacagctgtcttggaggaatcggccttacaagcggcg
gagcaggtggatcgacaggtggctcaagggatcccggtgggcccgctggcaggggtgccc
tttgccgtcaagaacttgtttgacgtggccggcctcaccaccctagctggctcggcgatc
aaccgcgagaatcccccggccatccaagatgcaacggtggtggctcgtctcaagcaggca
ggggcgatcttggtgggcaccctcaatatggacgagtacgcctatggcttcgtcaccgaa
aacagccactacggccccacccacaacccccacgatctcaaccgcagtgcggggggatcc
tctggcggctcggcagcagcggtggcaggaggtttggtgccccttgccctgggcagcgac
accaacggctcgattcgggtaccggcctctttgtgtggcgtctacggcctcaagcccacc
tatggccgtctgtcgcgggcaggggtggctctgtttgcccccagcttcgaccacgtgggc
cccttggcccgttcggtggccgatattgccctcagcttcgatgttatgcaagggccggat
ccccaagatcccgtctgtacccggcgtcctgtggatcccacctttgggcagttggggcag
gggatcgaaggcttgcgcatcgcggtggcggatgattactttgcccgaggggcagagctc
cccatcttggccggagtagaaaaagtggcccaagccctgggggcccgccagactgtgcgg
atcccggaagcccagcgcgcccgcgccgccgcctacctgatcacggctgccgagggagcc
aacctgcacctgcccaacctgcgaactcgcccccacgacttcgatccggccacccgggat
cgctttttggccggagctttgctgcccgccagttggatcttgcaggcgcagcgctttcgc
cgctggtaccgccagcaggtgcagaccatttttcaggagatcgatctgttcattgccccc
accaccccctgctctgcccccttacttggccaagagaagatggtgatcgatggggtagaa
gttctcacccggcccaacctcggcctctacactcagcccctctcgtttatcggcctgccg
gtgctttcagtgccgttgcgcgagagcggatccctgccctttggcgtacaactggtggcc
gccccctatcaagaagccaaactgctgcgggcagccgcctatttggagaagctagggatc
ccggatgcgcggcctgcctga

DBGET integrated database retrieval system