KEGG   Synechococcus sp. JA-3-3Ab: CYA_2177Help
Entry
CYA_2177          CDS       T00318                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00330  Arginine and proline metabolism
cya00332  Carbapenem biosynthesis
cya01100  Metabolic pathways
cya01130  Biosynthesis of antibiotics
cya01230  Biosynthesis of amino acids
Module
cya_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CYA_2177 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CYA_2177 (proB)
Enzymes [BR:cya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CYA_2177 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABD00317
CyanoBase: CYA_2177
CYORF: CYA_2177
UniProt: Q2JSQ2
Position
2192866..2193981
Genome map
AA seq 371 aa AA seqDB search
MAATEGTVVVKIGTSSLTDMQTGSLRLSVLGPLVEVLTRLRSQGYAVILVSSGAVGIGCA
RLGLRQRPTAIAEKQAVAAVGQGRLIRLYDDLFSALNQPIAQVLLTRGDFVERSRYVNAN
RTFTQLLQMGVIPIVNENDTVAVEELKFGDNDSLSALVASMVQAKWLILLTDVDRLYSAD
PHRDPSAEPIERVWRGMPLQIKAEAHGNSGWGTGGMATKLAAAQIATAAGVTVVITNGKR
PDQIPAILAGEPIGTRFEPAPQPVSARKRWIAYGLIPEGSLTLDEGAVRAICEQGRSLLP
AGITDVSGDFEAGAAVRLCDPGGREVGRGLVNYSAEELRRIKGKKTAEIPYILGYEGVDT
AVHRDNLALLD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaacagagggaacagtggtggtgaagatcggcacctccagcttgacagacatg
cagacgggctcgctgcgcctttccgtgctggggccgctggtggaggtgctgactcggctg
cgcagccagggctatgcggtaatcctggtctcctccggggcggtggggataggctgtgcc
cgcctgggcttgcgccaacggccgacggcaattgcggaaaagcaggcggtggcggcggtg
ggtcagggacggctgattcgcctgtacgacgatctcttctctgctctcaaccaacccatt
gcccaggtgctgctcacccgaggcgacttcgtggagcgcagccgctacgtcaatgccaat
cgcaccttcacccaactgctgcagatgggggttatccctatcgtcaacgagaacgatacg
gtggcagtggaggagctgaagtttggtgacaatgattccctctctgccctcgtggccagc
atggtacaggccaagtggctgatcctgctcaccgacgtggacaggctctattcggcggat
ccccatcgggacccctccgccgagccgatcgaacgggtgtggcgcgggatgccgctgcag
ataaaggcggaagcccacggcaacagtggctggggcaccggcggcatggcaaccaagctc
gctgcggctcaaatcgccaccgctgccggcgtgacggtcgtgatcaccaacggcaaacgg
cccgaccagatcccagccatcttagccggcgagcccattggcacccgctttgagcccgct
cctcagccggttagcgcccgcaagcggtggattgcctacggccttatccccgagggatcc
ctgactctggatgagggagccgtgcgggcaatctgtgagcaggggcgctcgctgctgccg
gcagggatcaccgacgtttctggcgactttgaggcaggggcagccgtgcgcctgtgcgat
cccggcggacgggaggtagggcggggcctggtcaactacagcgccgaggaactgcggcgg
atcaaaggcaagaaaaccgccgagatcccctacatcttgggctacgagggagtcgataca
gcggttcaccgggataacctggccctgcttgactaa

DBGET integrated database retrieval system