KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0245
Entry
CYB_0245          CDS       T00319                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00620  Pyruvate metabolism
cyb00640  Propanoate metabolism
cyb00650  Butanoate metabolism
cyb01100  Metabolic pathways
cyb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYB_0245 (pflB)
   00640 Propanoate metabolism
    CYB_0245 (pflB)
   00650 Butanoate metabolism
    CYB_0245 (pflB)
Enzymes [BR:cyb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CYB_0245 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABD01243
CyanoBase: CYB_0245
CYORF: CYB_0245
UniProt: Q2JPN9
Position
complement(256939..259245)
AA seq 768 aa
MVASVQRSVASPTELKAEPRTGSNAAGQKVLSDFATGAWQRCIDVRDFIQRNYTPYTGDE
TFLAAATERTQRLWAKVKDLMALERERGILDADTAVPSTITSHAPGYIDPELEQIVGLQT
DKPLKRAIMPFGGIRVVESSLKAYGYELDPRTKEIFTQYRKTHNDGVFDAYTEEMRRCRR
SGIITGLPDAYGRGRIIGDYRRVALYGVDRLIEDKQAQKASLDLDTMDEETIRLREELSE
QIKALQELKEMGSRYGFDLGRPAANAREAIQWLYLAYLAAVKEQNGAAMSLGRVSTFLDI
YIERDLQAGILTEEEAQELIDHFVMKLRMVRFLRTPEYNELFSGDPTWVTECIGGMGLDG
RPLVTKTSFRMLHTLYNLGPAPEPNLTVLWSERLPEAFKRYCAKVSIETSSIQYENDDLM
RPYWGDDYGIACCVSAMRIGKQMQFFGARVNLAKCLLYAINGGRDEISGEQVAPAFAPIT
ADVLDYDEVWPRMAQMMAWLAKTYVNTMNIIHYMHDKYCYERLEMALHDRDVLRTMAFGL
AGLSVTADSLSAIKYARVRAIRDERGLVVDYAVEGDFPKYGNNDDRVDSIAVQLVQTFMA
ELRKHKTYRNAIPTQSILTITSNVVYGKKTGNTPDGRRAGEPFAPGANPMHGRDTKGAVA
SLASVAKLPYDDALDGISNTFSIVPAALGRTAEERVANLVGLLDGYMRDGGFHLNVNVLN
RETLLHAMEHPELYPQLTIRVSGYAVNFIKLTREQQLDVINRTFHQHC
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggttgccagtgtgcagcgttctgtagcatcacctacagaattgaaggcggaaccaagg
acaggatccaacgcagccggtcaaaaagttttgagcgattttgcaacgggagcctggcag
cgctgcatcgacgtcagagactttattcagcgcaattacaccccctacaccggtgatgaa
accttcttagctgcagccaccgagcgcacccagcggctgtgggccaaggtcaaggatttg
atggctctggagcgagagcgagggatcctagatgccgataccgctgttccctctaccatc
accagccacgcccctggctatatcgacccagagctggaacagattgtggggctgcagacg
gacaaacctctgaagcgggccatcatgccctttggcggcatccgcgtggtggagtcttcc
ctcaaagcctatggctacgagctggatccccgcaccaaggaaatttttacccagtaccgc
aaaacccacaacgacggcgtttttgacgcctataccgaagagatgcgccgctgccgccgc
tccgggatcatcaccggcctgcccgatgcctacggtcggggtcgcatcattggggactac
cggcgggtggccctctacggggtggatcggctcatcgaagacaagcaggcccaaaaagcc
agtctagacctggacacgatggacgaagagaccatccgcctgcgggaggagctctccgag
cagattaaggccctacaagagctgaaagagatgggatcccgctacgggtttgacctgggc
cgtccggcagccaacgcccgcgaagccatccaatggctgtacctggcctacctggcagcc
gtcaaggagcaaaacggggcggccatgtccttggggcgggtgtccaccttcctggacatc
tacatcgagcgggatctgcaggccgggatcctcaccgaggaagaggcccaggagctcatt
gaccactttgttatgaagctgcgcatggtcaggtttttgcgcacgcccgagtacaacgag
ctattcagcggggatcccacctgggttaccgagtgcatcggcggcatgggcctggatggg
cggcctttggttaccaaaaccagcttccgcatgctgcataccctctacaaccttggccca
gcgcccgagcccaacttgaccgtgctctggtcggagcggctgccggaagccttcaagcgc
tactgcgccaaggtctccattgaaaccagctccatccagtacgaaaacgacgacttgatg
cgcccctactggggggatgactacggcatcgcctgctgtgtgtcggccatgcgcatcggc
aagcaaatgcagttctttggggcgcgggtgaacttggccaagtgcctgctctatgccatc
aacggcggtcgggatgagatctccggcgagcaggtggctcctgctttcgcccccatcacc
gccgatgtcctggactacgacgaggtgtggccgcgcatggcgcagatgatggcctggctg
gccaaaacctacgtcaacaccatgaacatcatccactacatgcacgacaagtactgctac
gagcgcctggagatggccctgcacgaccgggacgtgctgcgcaccatggcctttgggttg
gccggcctgtcggtaacagccgactccctatccgccatcaaatacgcgcgggtacgggcc
atccgggatgagcggggcctagtggtggattacgcggtggagggcgacttccccaaatac
ggcaacaacgacgaccgagttgactccattgcggtgcaactggtgcagaccttcatggcc
gagctgcgcaagcacaagacctaccgcaatgccatccccacccagtccatcctcaccatc
acctccaacgtggtctacggcaagaaaaccggcaatactcccgatgggcggcgagcgggc
gagccctttgccccaggggccaaccccatgcacggccgggacaccaagggggcggtggcg
tcgctggcttcggtggccaagctgccctacgacgacgctctggatgggatctccaacacc
ttctcgattgtgccggcggccctaggtcgcacagcggaggagcgggttgccaatctagtg
gggctgctggatggctacatgcgggatggcggtttccacctcaacgtcaatgttctcaac
cgcgagaccctgctgcatgccatggagcacccggagctctacccacagctcaccatccgg
gtttccggctatgcggtgaacttcatcaagctcacccgcgagcagcaactggatgtcatt
aaccgcacgttccatcaacactgctaa

DBGET integrated database retrieval system