KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0188Help
Entry
CYB_0188          CDS       T00319                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00790  Folate biosynthesis
cyb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CYB_0188 (folE)
Enzymes [BR:cyb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CYB_0188 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABD01188
CyanoBase: CYB_0188
CYORF: CYB_0188
UniProt: Q2JPT8
Position
complement(201389..202078)
Genome map
AA seq 229 aa AA seqDB search
MTLAKPGSGSQSRMDDKAHFKSRVIRDRATFAEEELGSSDVSDPAMVAAVETLLRGIGED
PQREGLRKTPERVVAALKFLTSGYRQSLEELLNSAIFDEGHDEMVLLRDVSLFSLCEHHL
LPFIGKAHVAYIPKQKVVGLSKIARIVEMYSRRLQVQERLTRQIAEALMEVLDPYGVGVV
IEATHMCMVMRGVQKAGSWTVTSSMVGVFQEDPRTREEFLSLIRHPSNF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgcgaaacccggatctggctcgcaatctcgaatggatgacaaagcccatttc
aagtctcgggtgattcgagatcgagccacttttgcggaagaagaattgggtagctcggat
gtctcagatccggctatggtggcggcggtggagacgctgctgcgggggatcggggaggat
ccccaacgggaggggctgcgaaaaaccccggaacgagtggttgcggctttgaagtttttg
accagtgggtatcggcagtctttggaggagctactgaacagtgccatctttgatgagggc
catgacgagatggtgctgttgcgggatgtgtctctgtttagcctgtgcgagcaccatctg
ctgccctttatcggcaaagcccatgtggcctacatccccaagcaaaaggtggtgggccta
agcaaaattgcccgtatcgtcgagatgtactcccgccgcctgcaggttcaggaacgcctg
acacggcaaattgctgaggccttgatggaggtgctggatccctacggggtgggggtggtt
atcgaggctacccacatgtgcatggtgatgcggggggtacaaaaggccggctcctggacg
gtcaccagctcgatggtgggggtgtttcaggaggatccccgtacccgcgaagagtttctg
agtctcattcgccatccgtccaatttttag

DBGET integrated database retrieval system