KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1016Help
Entry
CYB_1016          CDS       T00319                                 

Gene name
chlL
Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00860  Porphyrin and chlorophyll metabolism
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CYB_1016 (chlL)
Enzymes [BR:cyb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     CYB_1016 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ MeaB AAA_24 AAA_25 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: ABD01994
CyanoBase: CYB_1016
CYORF: CYB_1016
UniProt: Q2JMP3
Position
complement(1055032..1055883)
Genome map
AA seq 283 aa AA seqDB search
MEERAVKLAVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTII
DTLEAKGYHHEDIYPEDVIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDE
YDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKAKTRKLRLA
GLIGNRTSKRDLIDKYVSAVPMPVIEVLPLIEDIRVSRVKGKTLFEMAETDPSLEPVCQY
YLNIADELLARPEGIVPQPAEDRELFALLSDFYNTPARQLALV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacgcgctgtgaagttggcagtttacggaaaaggtgggatcggcaaatccacc
accagttgcaacatctcggtggccttggccaggcggggcaaaaaggtcttgcagattggc
tgtgatcccaagcacgacagcaccttcaccctgaccggctttctcatccccaccatcatc
gacactctggaagccaagggctatcaccacgaagacatctacccagaagatgtgatctac
cgcggctacggcggcgtggactgtgtggaagcgggtgggcccccggcaggggccggctgt
ggcggctatgtggtgggggaaaccgtcaaactcctgaaggagctgaacgccttcgatgag
tacgatgtcatcctcttcgatgtgctgggggatgtggtgtgcggcggttttgcggctccc
ctcaactacgccgactactgcctgatcgtaaccgacaacggctttgatgccctgtttgcc
gccaatcggattgctgcctcggtgcgagaaaaggccaaaacccgcaagctgcggttggcc
gggctgatcggcaatcgcaccagtaagcgggatctgattgacaaatacgtctcggcagtt
cccatgcccgttatcgaggtgcttcccctcatcgaagatattcgcgtctcgcgggtcaag
ggcaaaaccctcttcgagatggcggaaaccgatcccagcctggagcccgtctgccagtac
tacctgaacatcgccgatgagctgctggcccgcccggaagggatcgtgccccaacctgcc
gaggatcgggagctgtttgctttgctctccgacttttacaacaccccggcccgtcaactg
gccctggtgtga

DBGET integrated database retrieval system