KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1018Help
Entry
CYB_1018          CDS       T00319                                 

Definition
(GenBank) glucokinase regulator-like protein
  KO
K07106  N-acetylmuramic acid 6-phosphate etherase [EC:4.2.1.126]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00520  Amino sugar and nucleotide sugar metabolism
cyb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CYB_1018
Enzymes [BR:cyb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.126  N-acetylmuramic acid 6-phosphate etherase
     CYB_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS_2 SIS UBA_4 UPF0004 HOIP-UBA
Motif
Other DBs
NCBI-ProteinID: ABD01996
CyanoBase: CYB_1018
CYORF: CYB_1018
UniProt: Q2JMP1
Position
complement(1057548..1058462)
Genome map
AA seq 304 aa AA seqDB search
MAWDPRSLTESPNPATAEIDRLSTWELVKRINAEDRQVPEAVAAQAEPIAQAIDAIAQRM
RHGGRLIYIGAGTSGRLGVLDAAECPPTFGTSPAQVVALIAGGEKALTQAVEGAEDDAEA
AARALEGLHLQAQDSVVGIAASGRTPYVLGGIQAARSIGALTIGLACNHPSPLTEQVDIA
IAPLVGPEVILGSTRMKAGTAQKLVLNTISTGVMIRLGKTYGNLMVDLQASNAKLKQRAE
RMVALACDLDPAAAAQLLQACDGEVKTAILVALMGCSAQEARQHLQQAQGNIRQVLDSVL
AQRR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttggcttgggatcccagatccctgaccgaaagccccaacccggctacagccgagatcgac
cgtctcagcacctgggaactggtgaaacggatcaacgccgaggatcggcaggtgccggaa
gcggtggctgctcaggcggagccgattgcccaagccatcgatgccattgcccagcggatg
cgtcacggcgggcggctgatctatatcggggcaggaacctcaggtcggctgggggtactg
gatgcggctgagtgcccacccacttttggcacttcccccgcacaggtggtggctttgatc
gccgggggggaaaaagccctgacccaggcggtagagggtgcagaggacgacgcagaagcg
gctgcccgcgcgctggagggtcttcacctccaagctcaagatagtgttgtgggaattgcc
gccagcggtcgtaccccctatgtgctgggtgggatccaagccgccagaagtattggggcg
ctcacgattggcctggcctgcaatcacccttctcctctaaccgagcaggtggatattgct
attgcccctttggtggggccggaggtaatcctcggatccacccgcatgaaagccggcaca
gcccaaaagttggtgttgaacacgatctccaccggggtgatgatccgcttgggcaagact
tatggcaacctaatggtggatctccaggccagcaatgccaagctcaagcagcgggcggag
cgaatggtggccctagcctgcgatctggatcccgccgcggctgcccaattgctgcaggct
tgtgatggagaggtgaaaaccgcgatccttgtggccttgatggggtgctctgctcaggaa
gctcgtcagcacttgcaacaggcccagggcaacattcgccaggtgcttgattccgttctg
gcgcagcggcggtga

DBGET integrated database retrieval system