KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1390Help
Entry
CYB_1390          CDS       T00319                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00900  Terpenoid backbone biosynthesis
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
cyb01130  Biosynthesis of antibiotics
Module
cyb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CYB_1390 (ispE)
Enzymes [BR:cyb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CYB_1390 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABD02358
CyanoBase: CYB_1390
CYORF: CYB_1390
UniProt: Q2JLP6
Position
1461829..1462764
Genome map
AA seq 311 aa AA seqDB search
MQACTLIARAKINLYLEILGSRPDGYSEVAMVLQSIHLADRLQLKSRPHGIHLTCDRPEV
PTDARNLAYQAAELLQKECHSAAGVEIHIEKHIPVAAGLAGGSADAAAVLVGLNQLWGLG
LTVGELQSLAARLGSDIPFCIQGGTQLATGRGEVLEPLADWEGIPVLLAKPKHLGVSTAW
AYQAFRSRREILGATAPSEPALPTLPQALAALSRQDPPALARSLRNDLEQVVLPEYAIVG
ELRQALLSAGALGSLMSGSGPTVFGIMPSLELAAQARDTLRRQFQDVEFWVTQFAPTGIL
LQPDPCSLSPS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctgtaccctgattgcccgcgccaagatcaacctctacctggaaatcctcggc
tcccgtcctgatgggtattcagaggtggcgatggtgttgcagagcattcatttggcggat
cgcctgcagttgaagagccgtcctcacgggatccacctcacctgcgatcgtccagaagtg
cccacagatgcccgcaaccttgcctatcaagccgctgagctgctgcaaaaagagtgtcac
tctgccgctggcgtggagattcacatcgaaaagcacattccggtggcagcaggtttggcg
gggggctcggctgatgcagcggcggttttggtggggttaaaccaactgtgggggctgggc
ctgacggtgggagagttgcagagtttggcagcccgtctgggatccgacattcccttctgt
atccaggggggaacgcaactggccaccgggcgcggggaagttttggagccgctggccgat
tgggaagggatccctgtgctgctggccaagcccaagcacctgggggtttcgactgcctgg
gcctatcaagcctttcgttctcgccgggagatcttgggagcgactgccccatctgaaccc
gcgctgcccaccttgccgcaggcgttggcggctctcagccgtcaggatccgccggcgtta
gccaggagtttgcgcaatgacttggaacaggtggttttgccggagtacgcgattgtaggg
gaactgcgccaagctcttctctcggcgggggcactgggatccctgatgtcggggtcgggg
ccaacggtcttcggaatcatgcccagcctggagctggccgcccaagcgcgcgacaccctg
cgtcgccagtttcaagatgtggagttttgggtgacgcagtttgcccccaccgggattctg
ctgcagccggatccctgtagcctcagccccagctag

DBGET integrated database retrieval system