KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1704Help
Entry
CYB_1704          CDS       T00319                                 

Gene name
gap-2
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00010  Glycolysis / Gluconeogenesis
cyb00710  Carbon fixation in photosynthetic organisms
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
cyb01120  Microbial metabolism in diverse environments
cyb01130  Biosynthesis of antibiotics
cyb01200  Carbon metabolism
cyb01230  Biosynthesis of amino acids
Module
cyb_M00002  Glycolysis, core module involving three-carbon compounds
cyb_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cyb_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cyb_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_1704 (gap-2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYB_1704 (gap-2)
Enzymes [BR:cyb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     CYB_1704 (gap-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N Band_7_1 GFO_IDH_MocA DUF1110
Motif
Other DBs
NCBI-ProteinID: ABD02663
CyanoBase: CYB_1704
CYORF: CYB_1704
UniProt: Q2JKW5
Position
1788665..1789684
Genome map
AA seq 339 aa AA seqDB search
MVRVAINGFGRIGRNFLRCWLGRSQSNLDIVAINDTSDARTAAHLLKYDSILGPLQGADV
EPAENGLVVNGKHIYAVSDRNPSNLPWKEWKVDLVIEATGVFVDYQGASKHIEAGAKKVV
ITAPAKGGDIPTFVYGVNQHTYDPVRHNIVSNASCTTNCLAPIIKVLLDKFGVLRATMTT
THSYTGDQRILDGGHRDLRRARAAALSMVPTTTGAAKAVALVIPELKGKLNGVAVRVPTP
NVSLVDLVVQTERRVIAEEVNAALKEASETTMKGIIAYSDIPLVSIDYRGHDCSAIVDAE
MTSVLDGDLVKVMAWYDNEWGYSQRVLDLAEYMAAHWVE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggttagggtagccatcaacgggtttggtcgcattggtcgcaactttttgcgctgttgg
ctgggtcgctcccagtccaacctggacattgttgccatcaacgacacctcagatgctcgc
acggctgcccacctgctcaagtacgattccatccttgggccgttgcagggagcagacgtt
gagcctgcagaaaacggtttggtggtgaacggcaagcatatctatgccgtttccgaccgc
aaccccagcaacctgccctggaaagagtggaaggtggatcttgttattgaagctacaggt
gtttttgtcgactaccagggtgcctctaagcacatagaagcgggggccaaaaaggtggtg
atcaccgccccggccaaggggggagacattcccacgtttgtctacggtgttaatcaacac
acctacgacccggtgcggcacaacattgtcagcaacgccagctgcaccaccaactgcctt
gccccgatcatcaaggtgttgctggacaagttcggcgtcctccgtgccaccatgaccacc
acccacagttacaccggcgaccagcggatcttagatggtggtcaccgcgatctgcggcgg
gcccgggcagcagcattgagcatggtgcccaccaccacgggggctgccaaggcggtggct
ttggtgatcccggagctgaaaggcaagctgaatggggtggcggtacgggttcccacgccc
aatgtgtctctggtggacttggtggtgcaaacagagcggcgcgtgattgccgaggaggta
aacgctgccctgaaggaagcctcggaaaccacgatgaaagggatcatcgcctactcggat
attcccttggtctccatcgactaccgcggccacgactgctcggccattgtggatgcggag
atgaccagtgtgctggatggggatctggtcaaggtcatggcttggtacgacaacgagtgg
ggctactcccagcgggtgttggacttggcggaatacatggccgctcactgggtggagtag

DBGET integrated database retrieval system