KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1917Help
Entry
CYB_1917          CDS       T00319                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00240  Pyrimidine metabolism
cyb00250  Alanine, aspartate and glutamate metabolism
cyb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CYB_1917 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CYB_1917 (pyrB)
Enzymes [BR:cyb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CYB_1917 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABD02872
CyanoBase: CYB_1917
CYORF: CYB_1917
UniProt: Q2JKC1
Position
complement(2001751..2002731)
Genome map
AA seq 326 aa AA seqDB search
MVWQRQHVLGLADFTPEEYQMVLQTSASFQEVLTRRLPKVPTLQGKVVVTLFFEPSTRTR
TSFELAAKRLSADVLNFSPGTSSLSKGETLLDTARTFLAMGSDLLIVRHAQAGVPQQLAA
EIDRRGSPVGVLNAGDGLHEHPTQGLLDLFTLCSHLDPRRPRLELLQGIKIAIVGDILHS
RVARSDIYALVAAGAEVHLAGPPTLLPKDFAQFVPGHTLPIHWQLEPALEGARFVITLRL
QQERMGEFLLPSLQEYHHFFGLTRQRLRLCHPEVRVLHPGPVNRGVELSSEVMEDPGLNL
IEQQVTHGVAVRMALLYLMGGGRIPA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtttggcagcggcagcacgtcttgggcttggcggattttactcccgaagaataccag
atggttttgcagaccagcgccagtttccaggaggtgttgacgcggcggttgcccaaggtg
cccaccttgcaggggaaggtggtggtgacgctgttcttcgagccttccacccgcacccgt
accagttttgagctggcggccaagcgcctttcggcagatgtgctcaacttttccccaggc
acctcttccttgagcaaaggggagacgcttttggatacggcccgcacctttctggccatg
ggatccgatctcttaatcgttcgccatgcccaggcaggagtgccccaacaattagctgcc
gagatcgaccgccgcggatcccctgtgggcgttctcaatgccggggatggactgcacgaa
catcccacccaaggtttgctggatttgtttaccctctgcagccatctggatccccggcgt
ccccgtctggagttgctgcaagggatcaaaatcgccattgtcggcgatattctccactcg
cgggtggcccgctccgatatctatgccttggtggccgccggagctgaggttcacttagcc
ggccctcccaccctattgcccaaagattttgcccagtttgtacccggccacacgctccct
atccattggcagctggagcctgccctagaaggggcgcgttttgttatcaccttgcgcctg
caacaggagcgcatgggcgagttccttctccccagcttgcaggagtaccatcacttcttc
ggcctcacgcggcagcggctgcgcctgtgccacccagaggtgagggttttacaccccggc
ccggtcaatcgcggtgtggaactcagctccgaggtgatggaggatcccggcttgaacctg
attgagcagcaggtcacccacggcgtggcggtgcgcatggccctgctgtacctcatgggg
ggcgggcggatcccagcttag

DBGET integrated database retrieval system