KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2439Help
Entry
CYB_2439          CDS       T00319                                 

Definition
(GenBank) transcriptional activator TenA, putative
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00730  Thiamine metabolism
cyb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CYB_2439
Enzymes [BR:cyb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     CYB_2439
Transcription factors [BR:cyb03000]
 Prokaryotic type
  Other transcription factors
   Others
    CYB_2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: ABD03374
CyanoBase: CYB_2439
CYORF: CYB_2439
UniProt: Q2JJ15
Position
complement(2542402..2543061)
Genome map
AA seq 219 aa AA seqDB search
MPQSFTAHLWQAIQPIYKQILDHPFNRELAAGSLSRQRFQFYLQQDALYLTDFARALALI
GARSEGAEQVVSFLNFALGAIVAERSLHESYFRLYDIQPETAYAPACFAYTRFLLAAAAV
DPYEVAIAAVLPCFWIYREVGSAIYRTAQPDNPYQQWIDTYAGEEFAQVVQQALDITDSV
AQQATEPLREKMRAAFVTASRLEWLFWDSAYRLESWQPA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtcctttactgcccacctttggcaagccattcagcccatctacaagcaaatc
ctcgatcaccccttcaaccgagagttggcagcgggcagcctatcgcggcagcggttccag
ttttatttgcagcaagatgctctttatctcacggattttgcccgcgccctggccttgatt
ggagctcgttccgaaggggctgagcaggtggtgagtttcttgaactttgccctgggagcc
attgtggccgaacgcagcctgcacgaaagctattttcgcctctacgacattcaacccgaa
acagcctatgcccctgcctgcttcgcctatacccgttttttgttggctgcggcggctgtg
gatccctatgaggtggccattgccgctgtgctgccctgcttttggatctaccgagaggtg
ggatccgccatctatcgcaccgcacagcccgacaatccctaccaacagtggatcgacacc
tacgccggggaagaatttgcccaagtggtgcagcaggctttggacatcaccgactccgtc
gctcagcaggctacagagccgctgcgggaaaagatgagggcagcttttgtcactgcctcc
cggttggaatggctgttttgggacagtgcctatcgcctcgaatcttggcaacccgcctaa

DBGET integrated database retrieval system