KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2539
Entry
CYB_2539          CDS       T00319                                 

Definition
(GenBank) cytochrome, putative
  KO
K02720  photosystem II cytochrome c550
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    CYB_2539
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:cyb00194]
    CYB_2539
Photosynthesis proteins [BR:cyb00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    CYB_2539
SSDB
Motif
Pfam: Cytochrom_C550 Cytochrome_CBB3
Other DBs
NCBI-ProteinID: ABD03471
CyanoBase: CYB_2539
CYORF: CYB_2539
UniProt: Q2JIS7
Position
2643696..2644193
AA seq 165 aa
MPHLDQKLPMRWRIPSRLWAWVGILALLWLGLASPVAARIDPYVNQYLRVSGPVELPLDA
AGHTLTFTPEQLTDGKNRFQSACLNCHVGGATLPAPNISLSLKDLRGATPPRDTLQALME
YQRDPRSYDGSDSSYGCRPVPPSWMDDEAVNYPAPTAKRYGAGFQ
NT seq 498 nt   +upstreamnt  +downstreamnt
atgccgcatctggatcagaagttgcctatgagatggcggatcccgtctcgcctctgggcc
tgggtcgggatcctagctttgttgtggctggggctggccagtccggtggctgcccgcatt
gatccttacgtgaaccagtatttgcgggtgagtggccctgtggaattgcctctagatgcc
gcagggcataccctcacctttaccccagagcagctcacggacggcaaaaatcgttttcag
tccgcctgtttgaattgtcatgtgggcggtgccactttgccggctcccaacatttccctc
tctttgaaggacttgcgcggtgccactccaccccgagatacccttcaagccttgatggag
taccagcgggatccccgcagctacgatggctcggattccagctatggatgccgacctgta
cccccttcctggatggacgacgaagccgtaaactacccggctccgaccgctaagcggtac
ggagcgggctttcagtag

DBGET integrated database retrieval system