KEGG   Gloeothece citriformis: PCC7424_2838
Entry
PCC7424_2838      CDS       T00808                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cyc  Gloeothece citriformis
Pathway
cyc00620  Pyruvate metabolism
cyc00640  Propanoate metabolism
cyc00650  Butanoate metabolism
cyc01100  Metabolic pathways
cyc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC7424_2838
   00640 Propanoate metabolism
    PCC7424_2838
   00650 Butanoate metabolism
    PCC7424_2838
Enzymes [BR:cyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     PCC7424_2838
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACK71244
UniProt: B7K8P6
Position
complement(3150199..3152481)
AA seq 760 aa
MGVHLNSTDNPTQELDQLMNKEWQDFTSGTWQEEINVRDFIQKNYTPYSGDQSFLTDASE
RTQTLWTQVKLLMQQEREKGILDVETKVPSSITAHKPGYINKTLEQIVGLQTDKPLKRAI
MPYGGIRVVQKSLEAYGYKLDPQTEKIFTQYRKTHNDGVFDAYTSQMRKARHSGIITGLP
DAYGRGRIIGDYRRVALYGIDRLIKDKREQLTSLEVEVMDEDTIRLREEISEQIRALGEL
KEMAADYGFDISKPAANAKEALQWTYFAYLGAVKEQNGAAMSLGRTSTFFDIYIERDLKS
GLFTETDIQEFIDQFVMKLRMVRFLRTPDYNQLFAADPVWVTEVIGGVGEDGRPLVTKTS
FRFLHTLYNLGPAPEPNLTVLWSQQLPIAFKRYCAKVSIDTSSIQYENDDLMRPEYGDDY
GIACCVSAMRVGKQMQFFGARVNMAKALLYAINGGKDEKAGEQIAPSFAPITAEILDYEE
VTAKFDLLMDWLARLYINTLNVIHYMHDKYCYERLEMALHDRDVYRTMACGMAGLSVVVD
ALSAIKYATVKVIRNDQGLAQDYQIEGDYPKYGNNDDRVDEIAPNLVKTFMNKIRSNKTY
RNAVPTQSILTITSNVVYGKKTGSTPDGRKAGEPFAPGANPMHGRDSQGAIASCASVAKL
PYEHAQDGISYTFSIMPRALGKTQDTQINNLVGVLDGYFHDSGHHININVFERETLLDAM
DHPEKYPQLTIRVSGYAVNFIKLNREQQLDVINRTFHERI
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgggtgtacacttaaattctacagacaaccccactcaagaattagaccaattaatgaat
aaggaatggcaagattttacatcaggaacatggcaggaagaaattaacgttagagacttt
attcaaaagaattacaccccttatagtggagatcaaagctttttaacagacgctagtgaa
cgcactcaaactctttggacacaagttaaattattaatgcaacaggagcgagaaaaagga
atcttagatgtagaaaccaaagttccctctagtattaccgctcataagcccggatatatt
aacaaaaccctcgaacaaatcgtcggattacaaaccgataaacctctcaaacgtgccata
atgccctacggtggtatccgagttgtgcaaaaatccctagaagcttatggctataaactt
gacccccaaaccgagaaaatttttactcaataccgtaaaactcataatgatggggtattt
gatgcctatacgagccaaatgagaaaagctcgccatagtgggattatcacaggattaccg
gatgcctacggtcggggtcgtataattggggattatcgacgagtcgctttatatggaatc
gatcgcctgatcaaagacaaacgagaacaattaacctctttagaagtggaggttatggac
gaagacaccatccgcttacgggaagaaatctcagagcaaatccgagcattaggggaactc
aaagagatggccgccgattatgggtttgacattagcaaaccggctgccaacgccaaagaa
gccctacaatggacttatttcgcttatttaggggcagtcaaagaacaaaatggggcagcc
atgtccttggggcgtacctcgacctttttcgatatttatattgaacgggatcttaaaagc
ggactcttcacagaaacagatattcaagaatttatcgatcaatttgtgatgaaactgcgg
atggttcgtttcttgcggactccagactataaccaactctttgccgccgatccggtttgg
gtaacagaagtcattgggggagtcggagaagatggccggcctttagtgacaaaaaccagt
tttcgtttcctccataccctctataatttaggccctgcccccgaaccgaatttaaccgta
ttatggtcacaacaattaccgatcgcctttaaacgctactgtgccaaagtctctattgat
actagctccatccaatacgaaaatgacgacttaatgcgtccagaatacggagacgactat
gggatcgcctgttgtgtttctgcgatgcgcgtcggtaagcaaatgcagttttttggggca
agggttaacatggccaaagcattactgtatgctatcaacggcggaaaagacgaaaaagcc
ggcgaacagatcgccccttcttttgcccccattaccgcagaaattttggattatgaagag
gtaacagccaaatttgaccttttaatggactggttagctcgactctacattaataccctc
aacgtcatccattatatgcacgataaatattgttatgaacggttagaaatggccttgcat
gaccgagatgtttatcggacaatggcctgtgggatggccgggttatcggtagtcgtggat
gccttatctgccattaaatacgcaacggttaaagtcattcgcaatgaccaaggattagct
caagattaccaaatcgaaggggactatcccaaatatgggaacaacgacgatcgcgtcgat
gaaattgcccctaatttagtcaaaaccttcatgaataagatccgtagtaacaagacctac
cggaatgccgttcctacccagtctattctcaccattacctcaaacgtcgtttatggcaaa
aaaaccggtagtacccccgatggacgcaaagccggtgaaccctttgcccccggtgcaaac
cccatgcacggacgggatagtcaaggagcgatcgcatcctgtgcctctgtggcaaaactg
ccttatgaacacgcccaagacggaatttcctacaccttttccatcatgcctagagcatta
ggtaaaacccaagacacacaaatcaacaatcttgtcggtgtattggatgggtattttcac
gatagtgggcatcatatcaatattaatgtattcgagcgagaaaccctattagatgcgatg
gatcatcctgaaaaatatcctcaactcaccattcgggtatccggttacgccgtcaacttt
atcaaactcaaccgagaacaacaacttgatgtcattaaccgtaccttccacgaaagaatt
taa

DBGET integrated database retrieval system