KEGG   Cyanothece sp. PCC 7424: PCC7424_1961Help
Entry
PCC7424_1961      CDS       T00808                                 

Definition
(GenBank) CheA signal transduction histidine kinase
Organism
cyc  Cyanothece sp. PCC 7424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c Hpt HATPase_c_3 Asparaginase HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ACK70391
UniProt: B7KDT9
Position
2199864..2203037
Genome map
AA seq 1057 aa AA seqDB search
MTDDLFELQLQEELRQMFEVDTQTYLQSYISKILQLNPQTWKADIQEIYRAIHTIKGGAV
TVGADAILYVAIALEDLLSDLRYLEIAPSLEDGQMVQFLTEAGELLTSTLSITSTGEAAK
QEVLPTISRIEELRSIIQKDYIPEWNDNKVLHQEFAQQGFDLVILELEMGLEGLQEGQPL
NPDLINIAEQTLAQLREIGKSIQMDSGWGQLLQECKTLLVNEDSQVWLQEWPQYFKKLKS
CAMNSGKIPPLTGSETTDSIPVESIDLISVSDIEETLIEEYELEDLNLNSLVNFEDLSSA
LNYLQADQETLFHETISIENVPLLETESILNLEEINQIADNLEESLINLEGLDQLTLENT
LNNLNLDAIVEAVNLIEEQDLVSVDPTENGLDFNFDEIKNLVINLETSDLNQDPLPENIT
LSAPVSPQPQATQAKTTEEESHIQIPVSLGRANQISQHLVEVLLSARMASGLYNNLASQL
IKLFAIASESVNYITRLRQIQDDYAVQSDLNNPIKSNGVAVERYRQGYTTINRLLEISLR
LSELGAEASKITHSTHESFQSLERNILNLEQSIETSRVIPFKTVAFRARAIVRDLTNRYG
KPAQVVVKGEEIELDAGISAKLEPALLHLIRNAYDHGLEDPQERLKKGKLEKGTITISLE
RRGNQYLLTIADDGGGIDAAKVVKKAKEAHLPLTNAETSSGLLAVLCQPGFSSKDEVSEI
SGRGVGMDVVSTQVNSLNGKMSLDTVLGKGTSFKIQFPTPRLLVPCVLLHRNDPTGMSQS
RVRSFAIPIENVLTSTLWSNLLLKKTDESAVHSWTVTEENANVPALDLLEYWLGRSSQYP
ISETAIGVCVGGSNPDERLWLLADELGEQIELLNLPLPDPLVAPVGLLGMSLQIDGSLIP
VIDGATLAESLLTLNTTGSIPETVGGKKVEEVTRLTSQMILVVDDAALMRRRIEASLTAY
GHSVQTCADGLEAWNWLQYNPTPALLITDLEMPNMDGFTLIGRLRSEGATMPILVISSRL
SEEWNREAQRLGADGFLTKGFSTNELINKVNTLTSQV
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgatctatttgaattgcaactccaagaagaactacgccagatgtttgaagta
gatacccaaacttatctacaaagctacatctctaaaattctgcaattaaatcctcaaact
tggaaagcggatatacaagaaatttaccgggcgattcatacgattaagggaggggcggtt
acagttggcgctgatgccattctttatgtagcgatcgccctcgaagatctattatcagat
ctgagatatttagaaatcgctccttcgttagaagatggacaaatggttcaatttttaaca
gaagcgggagaattattaaccagtaccctttcaattaccagtacaggagaagcggccaaa
caagaagttttgcccactatttctcgcatagaagaactccgatctattattcaaaaagac
tatattcctgagtggaatgataataaagttttacatcaagaatttgctcaacaagggttt
gatttagtcattttagagttagaaatgggactagaagggttgcaagagggacaacccctg
aatccagacctaattaatatagccgaacaaaccctcgcccaactgcgagaaattggcaaa
agtattcaaatggacagtggatggggtcaattgctccaagaatgtaaaactttattagtt
aatgaagattctcaagtttggttacaagagtggccgcaatacttcaaaaaactgaaatct
tgtgctatgaatagcgggaaaattccgccactaactgggagcgagacaactgactcaatt
cctgtagaatctatcgatttaatttctgtgtctgatattgaagaaacgttgatcgaggag
tatgaattagaagaccttaatcttaattctcttgtcaattttgaagatctttcctcggct
ctcaattatcttcaagccgatcaagaaactttattccatgaaactatttctattgaaaat
gtacctctattagaaacagaatctattttaaatttagaagaaattaaccaaattgctgat
aacttagaagaaagtttaatcaatcttgaagggttagatcaattaactctagaaaatacc
ttaaataatttaaacctagatgcaattgttgaggcagttaatttaatcgaagaacaagac
ctagtttctgttgacccaacggaaaacggactagattttaattttgatgagattaaaaac
cttgtcattaatttagaaacctcagacttaaatcaagacccattacccgaaaatataact
ctttctgcgccggtttctcctcaaccccaagccacccaagcaaaaacgacggaggaagaa
agtcatattcaaatccctgtttctttaggtcgagctaatcaaatttctcaacatttagta
gaagttttattatcggcacggatggcaagcggactttataataatctggccagtcaactg
atcaaactgtttgcgatcgcttctgaaagtgtaaactatattactcgacttagacaaatt
caggatgattacgccgttcaaagtgatctcaataatccgattaaatctaatggggtggct
gtagaacgatatagacaaggctatactacaattaatcgactcttagaaatttccttacgt
ttatcagaacttggggcagaagcaagtaaaattactcattcgactcatgaaagttttcaa
tctctagaacgaaatattcttaatttagaacaaagtattgaaactagccgagtgatcccc
tttaaaactgtagcatttcgagctagagcgatcgtcagagatttaaccaaccgttatggg
aaacccgctcaagtggtggtaaaaggggaagaaatagaactcgatgcgggaattagtgct
aaattagagccggccttactacatttaatccgtaatgcttacgatcatggcttagaagat
ccccaagaacgcctaaaaaaaggaaaattagaaaaaggaacgattactatatctttagaa
cgccgggggaatcaatatttattaactattgccgatgatggggggggaattgatgcggcc
aaagtggtcaaaaaagcgaaagaggctcatttacccttgactaatgcggaaacgtcctcc
gggttattagcggttttatgtcaaccagggtttagttctaaggacgaggtgagcgaaatt
tctggccgaggagtgggaatggatgtggtatcaactcaggtcaacagtttaaatggcaag
atgagtttagatacggttttaggtaaggggactagctttaaaatacagtttcctactcct
cgtctattagttccctgtgtcttgctgcaccgaaacgaccccaccgggatgtctcagagt
cgagtccggtcttttgctatccccatagaaaatgttctcacctctaccttgtggagtaat
ttactcctaaagaaaaccgatgagtctgctgttcattcttggactgttacggaagagaac
gccaatgttccggctttagatctgctggaatattggttaggacgttcttctcaatatcct
atttcagaaaccgcgatcggggtatgtgtaggggggtcaaatccggatgagcgcctttgg
ttactggccgatgagttaggagaacaaatcgagttactgaatttaccgttacctgatcct
ctggttgctccggttgggttgctagggatgagtcttcaaatagatggaagtttgatcccg
gtgattgatggggcgacactggcagagtctttattgacgcttaacacgactggatctatc
cctgagacggtaggagggaaaaaggttgaggaagttacccgcttaacgagtcagatgatt
ttggtggtagatgatgccgccttgatgagaagacgaattgaggcgagtttaaccgcttat
ggtcattctgtccaaacctgcgccgatgggttagaagcctggaactggttacaatacaat
cctacaccagcgttactgattacggatttagaaatgccgaatatggatggttttacgtta
attgggcgtttacgaagtgagggggcgactatgcctattttggtgatttcctctcgctta
tcggaagaatggaaccgggaagcacaacggttaggggcggatggtttcctgactaaaggg
ttttctactaatgagttgattaataaggttaataccctaacctctcaagtgtag

DBGET integrated database retrieval system