KEGG   Cyanothece sp. PCC 7424: PCC7424_2293Help
Entry
PCC7424_2293      CDS       T00808                                 

Definition
(GenBank) photosystem q(b) protein
  KO
K02703  photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00195  Photosynthesis
cyc01100  Metabolic pathways
Module
cyc_M00161  Photosystem II
cyc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    PCC7424_2293
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:cyc00194]
    PCC7424_2293
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     PCC7424_2293
Photosynthesis proteins [BR:cyc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    PCC7424_2293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Photo_RC
Motif
Other DBs
NCBI-ProteinID: ACK70715
UniProt: B7KHM0
Position
complement(2562885..2563955)
Genome map
AA seq 356 aa AA seqDB search
MTTTLQQRESVSLWEQFCQWITSTNNRLYIGWFGVIMIPTLLTATTCFIIAFIAAPPVDI
DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL
IGVFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLGISGTF
NFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGISTMAFNLNGF
NFNQSILDSQGRVISTWADVLNRANLGFEVMHERNAHNFPLDLASAEPVVAPSING
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgactactactttacagcaacgcgaaagcgtttccctgtgggaacagttttgtcagtgg
atcaccagcaccaacaaccgtttatacatcggttggttcggtgtcatcatgatccccacc
ctcttaactgctactacctgtttcatcattgctttcatcgctgctcctcctgtggacatc
gatggaatccgtgaacccgtagctggttctttactctacggaaacaacatcatctctggt
gcagttgttccttcttccaacgcaattggattacacttctaccccatctgggaagccgct
tccttagatgagtggctctacaacggtggcccttaccaattagtagtattccacttctta
atcggagtattctgctacatgggtcgtcagtgggaattaagctaccgcttaggaatgcgt
ccttggatttgtgtagcttactctgcacccgtatccgcagctaccgcagtattcttaatc
taccccatcggacaaggttctttctctgatggaatgcctttaggaatctctggtactttt
aacttcatgttcgttttccaagcagaacacaacatcttaatgcaccccttccatatgttg
ggagtagctggtgtattcggaggttctttattctctgcaatgcacggaagcttagtaacc
agttctttagttcgtgaaactaccgaagtagaatctcagaactatggttacaaattcgga
caagaagaagaaacctacaacatcgtagcagcacacggatacttcggacgtttaattttc
caatatgcgtccttcaacaacagccgttcattacacttcttcttaggagcatggcctgta
atcggtatttggttcaccgcaatgggaatctctaccatggccttcaacctcaacggtttc
aacttcaaccagtctatccttgattctcaaggtcgtgtcatcagcacctgggctgacgta
ttaaaccgcgctaacttaggatttgaagtaatgcacgagcgcaacgctcacaacttcccc
ttagacttagcgtctgctgaacctgttgttgctccttccatcaatggctaa

DBGET integrated database retrieval system