KEGG   Cyanothece sp. PCC 7424: PCC7424_2403Help
Entry
PCC7424_2403      CDS       T00808                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PCC7424_2403
Enzymes [BR:cyc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PCC7424_2403
DNA repair and recombination proteins [BR:cyc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PCC7424_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Helicase_RecD PIF1 PhoH UvrD_C T2SSE HHH_2 HHH_3 UvrD-helicase AAA_16 AAA_22 Mg_chelatase NACHT
Motif
Other DBs
NCBI-ProteinID: ACK70824
UniProt: B7KIY8
Position
complement(2677531..2679774)
Genome map
AA seq 747 aa AA seqDB search
MNLRDSCVPYRCPTPESLTGVVERITYHAEESGYTVARIQCPRAKELVTVVGNFANIQAG
QTLQLKGIWKNHPQYGQQFEVQQYTETKPATLTGMEKYLGSGLIKGLGPVMARRIVAHFG
LETLEIIENKTERLIEVPGIGKKRVVMIQKAWATQKAIKEVMVFLQGHGVSTAYAVKIFK
QYGQNAIATVTDNPYQLADDIYGIGFLTADKIAQNVGVSPWSKYRYKSGLLHVLSQAAED
GHCFLPQPELMKLGAEILSNGGHQAEIEAISAIIEEMGQQQALMVEKGEGGMPLCYKPAF
FYTEENLAQLLRQQLSLPVEVDLPRVRNWIERFTQSRGISLSPQQQQAVEMAVSSRIMVL
TGGPGTGKTFCTRTIVALWKAMGKKIGLAAPTGRAAQRMGEVTGLEAKTLHRMLEFDPST
MGFKRDKDNPLPYDALVVDETSMLDLFLAHSLLKAIASGACLLLVGDRDQLPSVGPGKVL
ADLIDSGKIPIVRLSVVFRQASQSAIIRAAHQINEGQYPYLEPISDPAKSDCLWHNGGTE
PEHGVQVVCELIRDFIPRQGFNPLTDVQVLCPMTRGAVGTRNFNQVLQQLINPPSPDKAE
VSTRGMTFRVGDRVIQLKNDYEREVFNGDLGRVWAIDPVEQELTICFDGRDVVYDFADLN
EIALAWSISIHKSQGSEYPVVLLPIYTSHYIMLSRNLIYTGLTRAKKLAIIIGSSKAIGM
AVRQVNQQERYTRLKERLGVKLMEVWR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaatctaagagactcctgtgtaccttatcgatgtccaactcctgaatcgcttaccggc
gtggtagaacgcattacctatcacgccgaagaatcgggttataccgtcgctcggatacaa
tgccccagagcaaaggaattggtgacggtagtgggcaactttgccaatattcaagccgga
cagactcttcaactcaagggaatctggaaaaatcacccccaatacggacagcagtttgag
gttcagcaatacactgaaaccaaaccggccacactcacgggcatggagaaatatttgggc
agtggcttaataaaaggacttggcccagtaatggccagacgaatcgtagcccactttggg
ctagaaaccctagaaatcatcgaaaataagaccgaaaggctgattgaagtcccaggcatc
ggcaaaaagcgcgttgtcatgattcaaaaggcttgggctacccagaaagctatcaaagaa
gtcatggttttcttgcagggacatggggtttctactgcttacgccgttaaaatctttaag
cagtacggacaaaatgcgatcgccaccgttaccgataatccctatcaactcgccgatgat
atttatgggatcggttttttgacagccgataaaattgcccagaatgtaggggtgtctccc
tggtcaaaatatcgctacaaatcgggtcttctgcacgttttaagccaagccgccgaggac
ggacattgttttttacctcaaccagaattgatgaagctaggagcggaaattctcagtaat
gggggacatcaagccgaaatagaagcgattagtgccattattgaggagatggggcagcaa
caagccttaatggtggaaaaaggagagggggggatgcctttatgctacaaaccggctttc
ttttatactgaagaaaaccttgctcaattactgcgacaacaactttcactaccggttgaa
gtggatttaccccgtgttaggaattggatagaacgttttactcaaagtcgggggatttct
ctttctccccaacagcaacaagcggtagaaatggccgtttcttcacggataatggttctc
acaggggggccaggaacgggaaaaaccttttgtacccgtactattgtagctttatggaag
gcgatggggaagaaaatcgggttagccgctcccaccggacgggcagcccagagaatggga
gaggtgacgggtttagaagctaaaactctccacagaatgctcgaatttgacccgtccacg
atgggatttaaacgagataaagacaatcccctgccctacgatgctttagtggtagatgaa
acttcgatgctggacttgtttctggctcattcgttgttaaaagcgatcgcatcgggggct
tgtttattgttagttggtgaccgggatcaattgcccagtgtggggccaggaaaagtttta
gccgacttgattgattcggggaaaattcctatcgtgcgtctgtcagtagttttccgacaa
gcttcacagagtgctattattcgggcggcacaccaaattaatgagggtcaatatccctac
ttagagccgattagcgaccctgctaaatcagattgtctgtggcacaatgggggaactgag
ccagaacatggggttcaagttgtatgtgaactgatccgtgatttcattcctcgtcagggt
tttaatcccctaacagatgtacaggtattatgtcccatgacaaggggagcagtggggaca
cgcaattttaaccaagtgcttcagcaattaattaaccctccaagtcccgataaagccgaa
gtttccacaagggggatgacttttcgagtgggagatagagtgattcaactgaagaatgat
tatgagagagaagtgtttaatggagatttagggagagtatgggctattgatccagttgaa
caagaactaactatctgctttgacgggcgagatgtggtttatgattttgctgacctcaat
gaaatagctttagcttggtcgatttccatccataaaagccaagggtcagagtatccagtc
gttttgctgccgatttacaccagtcattatataatgctctctcgaaatctcatttacact
gggctaactcgtgctaagaagttagcaattatcattgggtcttctaaagcaatagggatg
gccgtaaggcaagtgaaccaacaggagcgttatacaaggctcaaagagcgcttaggggtt
aaattaatggaagtgtggcgatag

DBGET integrated database retrieval system