KEGG   Cyanothece sp. PCC 7424: PCC7424_2652Help
Entry
PCC7424_2652      CDS       T00808                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00220  Arginine biosynthesis
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01130  Biosynthesis of antibiotics
cyc01230  Biosynthesis of amino acids
Module
cyc_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PCC7424_2652
Enzymes [BR:cyc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     PCC7424_2652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ACK71065
UniProt: B7KKU6
Position
complement(2935671..2936600)
Genome map
AA seq 309 aa AA seqDB search
MSLKTLQGKDILSIADLSPSQILDLLQLATELKKGDKKPVCNKILGLLFYKASTRTRVSF
TTAMYQLGGQVIDLNPSVTQVGRGEPISDTARVLDRYLDLLAIRTFKQEDLQTFADYADI
PIINALSDLEHPCQILADLLTIQENFGTLSGITLSYLGDGNNVAHSLLLGGALMGMKIRI
ATPNHYKPNSDMIEKAKEFASSNGGDVLWTEDPIEATAQTQVLYTDVWASMGQEDSADSR
IPVFQPYQLNEALLTHAHKEAIVLHCLPAHRGEEITQGVIEGKQSRVWDQAENRMHAQKA
LMVSVLGLE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaaaactttacagggaaaagatatcttaagtattgccgatcttagtccttca
caaattttagacctgttacaattggctacggagttaaaaaagggagataaaaaaccagtc
tgtaacaaaattttaggcttacttttttataaagcctccacccgtacccgagtctctttt
acaacggctatgtatcaattagggggtcaagtgattgatcttaatcccagtgtaactcaa
gtcggtcgcggagagccgatttctgacacagctagggtgttagatcgctatttagatctg
ttagccatacgtacctttaagcaggaagatttgcaaaccttcgctgattatgcggatatt
cctattattaatgctttaagtgacttagaacatccctgtcaaattttagcagatttgctt
accattcaagagaattttgggacattgtccggtatcactctatcttatctcggagatggg
aataatgtcgctcattccctgttattgggaggagcattgatggggatgaaaatccgtata
gctaccccaaatcattacaaacctaatagcgatatgatcgagaaggctaaggagtttgcc
tctagtaacggaggagatgttctctggactgaagatcctatcgaagcaacggctcaaact
caagttttatatactgatgtgtgggcttctatgggacaagaagactcggctgattcaaga
atacctgtgtttcagccttatcagttaaatgaagccttattaacccatgcccataaggag
gcgatcgttttacactgtttaccggctcaccgaggagaagaaattacacaaggagtgatt
gaaggaaaacaatctcgggtttgggatcaagcagaaaaccgaatgcacgctcaaaaagct
ttaatggtgagtgttttgggacttgaataa

DBGET integrated database retrieval system