KEGG   Gloeothece citriformis: PCC7424_2848
Entry
PCC7424_2848      CDS       T00808                                 
Name
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
cyc  Gloeothece citriformis
Pathway
cyc00061  Fatty acid biosynthesis
cyc00780  Biotin metabolism
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01212  Fatty acid metabolism
cyc01240  Biosynthesis of cofactors
Module
cyc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PCC7424_2848
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PCC7424_2848
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PCC7424_2848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cyc01004]
    PCC7424_2848
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     PCC7424_2848
Lipid biosynthesis proteins [BR:cyc01004]
 Fatty acid synthase
  Component type
   PCC7424_2848
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase THF_DHG_CYH_C ACT_7 Shikimate_DH
Other DBs
NCBI-ProteinID: ACK71253
UniProt: B7K8Q5
Position
3166109..3166849
AA seq 246 aa
MKQLQDQVALVTGASRGIGRAIAIALAAEGAKVVVNYARSSGAAEDVVKEITTNDGEAIA
LQADVSKAEEVEELIKKTLDKFGRIDILVNNAGITKDTLLMRMKPEDWQAVIDLNLTGVF
LCTRAVTKPMLKQRSGRIINIASVAGQMGNPGQANYSAAKAGVIGFTKTVAKELASRGIT
VNAVAPGFITTDMTSDLKSEDILKFIPLGRYGQPEEIAGMVRFLAGDAAAAYITGQVFNV
DGGMVM
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaaacaattacaagatcaagtggcgttggtaacaggggcatctagaggcattggccgg
gctattgcgatcgccttagcagcagaaggagcaaaagtagtcgttaattatgcccgttcg
agtggggcagccgaagacgtagttaaagagatcaccacaaacgacggagaagcgatcgcc
cttcaagcagatgtgtctaaagctgaggaagtagaagaactcattaaaaaaactctcgat
aaatttggacggattgatattttagtcaataatgctggtattactaaagatactttattg
atgcggatgaaacccgaagactggcaagcggtgatcgatctcaacttaactggcgtattt
ttgtgtactcgcgccgtaaccaaaccgatgttaaaacaacggagcgggcgtattattaat
attgcctccgtcgccggacaaatgggcaacccaggacaagctaattatagtgccgctaaa
gccggagtgattggatttacaaaaaccgttgctaaagaattagccagtcgaggcattacg
gttaatgcagtcgcccccggttttatcactaccgatatgactagcgacctcaagtctgaa
gatattctaaaatttattcctctaggacgatatggacaaccggaagaaattgcggggatg
gttcgctttctggcaggggatgcggcagccgcttacatcaccggtcaagtctttaacgtc
gatggcgggatggtaatgtag

DBGET integrated database retrieval system