KEGG   Cyanothece sp. PCC 7424: PCC7424_3203Help
Entry
PCC7424_3203      CDS       T00808                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00010  Glycolysis / Gluconeogenesis
cyc00620  Pyruvate metabolism
cyc00640  Propanoate metabolism
cyc00680  Methane metabolism
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01130  Biosynthesis of antibiotics
cyc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_3203
   00620 Pyruvate metabolism
    PCC7424_3203
   00640 Propanoate metabolism
    PCC7424_3203
  Energy metabolism
   00680 Methane metabolism
    PCC7424_3203
Enzymes [BR:cyc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PCC7424_3203
Lipid biosynthesis proteins [BR:cyc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PCC7424_3203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACK71604
UniProt: B7KCQ3
Position
complement(3590639..3592606)
Genome map
AA seq 655 aa AA seqDB search
MTTNTIESVLNENRLFPPSPEFSQNAYIKSFEDYKQIYEKAKADPESFWAELAEKELHWF
QKWEKVLDWQPPFAKWFVGGKINISYNCLDRHLTTWRKNKAALIWEGEPGDTRTLTYAQL
HREVCQFANVLKQLGVHKGDRVGIYMPMIPESAIAMLACARIGAPHTVVFGGFSSEALKD
RLNDAEAKLVITADGGFRKDKVVALKEQVDLAIADNGVPSVERVLVVQRTKEPVTMVEGR
DYWWHELQKEASPNCPAEAMDSEDMLFILYTSGTTGKPKGVVHTTGGYNLYTHLTTKWIF
DVKDDDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGVPRPSNPGCFWDVIEKYGVNI
FYTAPTAIRAFMKMGDGLPNARNLSSLRLLGSVGEPINPEAWMWYHQVIGGEKCPIVDTW
WQTETGGIMITPLPGATTTKPGSCTLPFPGIIADVVDLDGNPVNVNEGGYLVVKHPWPGM
MRTVYKNPERFRNSYWEHIYPKDGQYFYFAGDGARRDEEGYFWVMGRVDDVINTSGHRLG
TMEVESALVSHPAVAEAAVVGRPDEVKGEDIYAFVTLENNYSPSDELMKELKDHVAKEIG
AIARPGTIHFTDVLPKTRSGKIMRRLLRNLAAGQEVAGDTSTLEDVGVLEKLRGG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaacactattgaatccgttcttaacgaaaatcgcttatttcccccatcccct
gaattttcacaaaatgcctatataaaaagctttgaagactataagcaaatctacgagaaa
gctaaggctgatcccgaaagcttttgggcagaattagccgaaaaagaattacactggttt
caaaagtgggaaaaagttctcgactggcaacctccctttgctaaatggtttgtgggggga
aaaattaatatttcttacaactgtcttgacagacatttaacaacttggcgcaaaaataaa
gccgccctcatctgggaaggcgaacccggcgacacccgtaccctcacctacgcccaactg
catcgagaagtctgtcaatttgccaatgtcctcaaacagttaggagttcataaaggcgat
cgcgtaggcatctatatgcccatgatcccagaatctgcaattgccatgttagcctgtgcg
agaattggcgcacctcataccgtcgttttcggtgggtttagttcagaagccctcaaagat
cgtcttaatgatgcagaagctaaacttgtgatcacggcggatggagggtttcgcaaggat
aaagtcgttgccctcaaagaacaagtcgatctagcgatcgccgataatggtgttcccagt
gtagaacgagttttagttgtccaacgcaccaaagaacccgtcacgatggtagaagggcgc
gactactggtggcatgaactgcaaaaagaagcctcccctaactgtccggctgaggcgatg
gatagtgaagatatgttgtttatcctctacaccagtggaacaaccgggaaaccaaaagga
gtggttcataccactggcggctacaacctttacacccatctaactacaaaatggatcttt
gatgtcaaagatgatgatgtctattggtgtacggcggatgtgggttggatcaccggtcat
agttatattgtctatgggcctttatccaatggggcaactacgcttatgtatgaaggcgtt
ccccgcccatctaaccccggctgtttctgggatgtgatcgaaaaatacggggtcaacatt
ttttatactgccccaaccgctatccgcgcctttatgaagatgggtgacggactccccaat
gcccgcaatttatcgtctctgcgactattgggaagcgtgggagaacccattaatccagag
gcttggatgtggtatcatcaagtcattggtggggaaaaatgcccaattgtcgatacttgg
tggcaaacagaaaccggcggcattatgatcactcccttacccggcgcaacgacgactaaa
cccggatcttgtacccttcctttccccggtattatcgcggatgtggttgacttggatggc
aacccggttaatgtgaatgaagggggttatctggtggtcaagcatccttggccaggaatg
atgcgaaccgtttacaaaaaccctgaacgcttccgtaatagttactgggagcatatttat
cccaaagacgggcaatatttctattttgctggtgatggggcgcgtcgagatgaagagggt
tatttttgggtgatggggcgggttgatgatgtgattaatacatcgggacaccgcttagga
acgatggaagttgagtctgctttagtctctcatcctgcggtggcagaagcggcggtagtc
ggacgaccggacgaggttaaaggggaagatatctatgctttcgttaccttagaaaataat
tatagccccagtgatgaattaatgaaagaattaaaggatcacgtggcgaaagaaattggg
gcgatcgcccgtccgggaacaattcattttacggatgtattgcctaaaacccgttccggt
aaaattatgcgacggttgttacgtaatttagccgccggtcaagaagtggcaggggatacc
tcaaccttagaagatgtgggggtattagaaaagttacgcggcggctaa

DBGET integrated database retrieval system