KEGG   Cyanothece sp. PCC 7424: PCC7424_3782Help
Entry
PCC7424_3782      CDS       T00808                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00030  Pentose phosphate pathway
cyc00710  Carbon fixation in photosynthetic organisms
cyc01100  Metabolic pathways
cyc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PCC7424_3782
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC7424_3782
Enzymes [BR:cyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     PCC7424_3782
    4.1.2.22  fructose-6-phosphate phosphoketolase
     PCC7424_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACK72163
UniProt: B7KJ79
Position
complement(4207741..4210149)
Genome map
AA seq 802 aa AA seqDB search
MVAAPEKPTIQQDPLSAEELRKIDAYWRACNYLAVGMIYLKDNPLLKRPLQPEDIKPRLL
GHWGTSPGLSFTYVHLNRLINKYDLDMIYMAGPGHGAPGVLGPVYLEGTYSEIYPDKSED
EEGMQKFFKQFSFPGHIGSHCTPETPGSIHEGGELGYSVSHAYGAAYDNPDLIVSVVVGD
GEAETGALATSWHSNKYLNPIRDGAVLPILHLNGYKIANPTILARITPEELESLFIGYGY
TPYVVEGDDPHLMHQKMAATLEHCINQIRHIQQEARSSGVVHRPRWPMIILRSPKGWTGP
KEVDGHKVEGFWRAHQVPMGNMQNNPEHLRMLEEWMKGYRPDELFDENGKLIPELKELAP
KGHRRMSANLHANGGVLRKDLRMPDFRDYAVEISTPGTEEVENTRLLGEFLRDVMRNNMT
SFRLFGPDETASNRLQAVYEVSQKTWMAEFYPEDLDGSYLSREGRVMEMLSEHTLEGWLE
GYLLTGRHGFFHTYEAFAHVIDSMFNQHAKWLDICKHDVHWRASVSSLNILLSSVVWRQD
HNGFSHQDPGFIDLVTNKSAEVVRVYLPPDANCLLSVANHCLRSKDYVNVIVADKQKHLQ
YLSMDEAIKHCTKGIGIWEWASNDDQGKEPDEPDVIMACCGDIPTMESLAATAILREEFP
ELKVRFINVVDLFKLQSESEHPHGLSEWDFDSLFTHDKPIIFNFHGYPWLIHKLTYRRSN
QERIHVRGYKEEGNINTPLELAIRNQVDRFNLVIDVIDRVPKLGSAAAYVKERMKNEIID
NLQHAFEQGSDKPEIVEWKWPY
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcagcaccagaaaaaccaaccatacaacaagaccccttatctgctgaagaactc
cgaaaaatagatgcttactggcgagcttgcaactatttggctgttgggatgatttatctc
aaagataatcctttactcaaaagacccctacaacccgaagacattaaaccccgcttgctc
ggacattggggaacatcgcccggattaagtttcacttatgttcacctcaatcgactgatc
aacaaatatgatttagacatgatttacatggccgggccgggtcatggtgcgcctggggta
ctcggccctgtttacttagagggaacatactcagaaatttatcccgataagagcgaagat
gaagaaggaatgcaaaaattctttaaacagttttcctttcccggtcatatcggaagtcac
tgtacccctgaaactcccggctctatccatgaagggggagaattaggatacagcgtttcc
catgcttacggtgcagcttatgataatccagatttaattgtatcagtagttgtgggagac
ggagaagcagaaaccggagccttagccacctcctggcactccaacaaataccttaacccg
attcgagacggggcagtcttacccattttgcaccttaacggctataaaattgctaatcca
acgatcctcgctcgtattacccctgaagaactcgaaagcttatttattgggtatggatac
accccttatgtggtcgaaggggatgatccccacctgatgcaccaaaaaatggccgccacc
ctagaacactgtatcaaccaaattcgccatatacaacaagaagcccgcagcagtggagtc
gtacaccgtcctcgctggccgatgattattcttcgcagtcctaaagggtggacagggcca
aaagaagtcgatgggcacaaagtcgaagggttttggcgggcgcatcaagtgccaatggga
aatatgcaaaataatcccgaacacctgagaatgttagaagagtggatgaaaggttataga
ccggatgaactcttcgacgagaacggtaaactcattcccgaactgaaagaacttgctccc
aaaggacatcggcggatgagtgctaacctccatgccaacggtggggtattacgaaaagat
ttaagaatgcccgattttcgggattatgcggtggagatttctacccctggcacagaagaa
gtcgaaaatactcgcttattgggtgagtttttacgggatgtgatgagaaataacatgacc
tccttccgtctctttggccctgatgaaaccgcctccaaccgtcttcaagcggtatatgaa
gtgagtcaaaaaacctggatggctgagttttaccctgaagatttagacggaagctactta
tcccgtgagggtcgagtgatggaaatgctcagtgagcataccctagaaggatggttagaa
ggatatctcttaaccggaagacatggatttttccatacttatgaagcttttgcccacgtt
attgattcgatgtttaaccaacacgccaaatggttagatatttgtaaacatgacgttcat
tggcgagcttcagtttcttccttaaatattctcctgtcttctgtcgtttggcgacaagat
cataacgggtttagtcaccaagatcccggttttatcgatttagtaactaataagagtgcg
gaagtggtgcgggtttatctccctcccgatgccaattgtttgctctcagtagcgaatcac
tgcttacggagtaaagactatgttaacgtcatcgtggctgacaaacagaagcacctgcaa
tatctcagcatggacgaagccattaaacactgtactaaaggaattggcatttgggagtgg
gcgagtaatgatgaccaagggaaagaaccggacgaacccgacgttatcatggcttgttgt
ggtgatattcctacaatggaatctttagcggctactgctattttacgggaagaatttcct
gagcttaaagtgcgttttattaacgtagttgacctatttaagttacaatctgaaagcgaa
caccctcacggattatctgaatgggattttgatagtctctttactcacgataaaccgatc
atctttaactttcatggttatccctggttaattcataaactaacctatcggcgtagtaac
caagaacggattcatgtaagaggttacaaagaagaagggaatattaacacccctctagaa
ttagccattagaaaccaagtcgaccggtttaacctcgtaattgatgtgatcgatcgagtt
cctaaattaggatcagccgccgcctatgttaaagagcggatgaagaacgaaattatcgac
aaccttcaacacgcttttgaacagggtagcgataaacccgaaatcgttgaatggaagtgg
ccttattag

DBGET integrated database retrieval system