KEGG   Cyanothece sp. PCC 7424: PCC7424_4525Help
Entry
PCC7424_4525      CDS       T00808                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00860  Porphyrin and chlorophyll metabolism
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC7424_4525
Enzymes [BR:cyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PCC7424_4525
Exosome [BR:cyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC7424_4525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACK72888
UniProt: B7KAB4
Position
5002924..5003913
Genome map
AA seq 329 aa AA seqDB search
MFPTTRPRRLRQTSQLRRMVRETVLTPDDLIYPLFAVPGEGIASEVKSMPGVFQLSVDKI
VQEAKEVYDLGIPSIILFGIPEDKDTDATGAWHDCGIVQKAATAVKEAVPDLIVIADTCL
CEYTNHGHCGYLEVGDLSGRVLNDPTLELLKKTAVSQAKAGADIIAPSGMMDGFVTTIRQ
ALDEAGFEDTPILSYAAKYASAYYGPFRDAADSTPQFGDRRTYQMDPANAREALKEVELD
IAEGADMLMVKPALSYMDIIWRVKEITNLPVAAYNVSGEYSMIKAAALNGWIDEQRVTLE
TLISFKRAGADLILTYHAKDAARWLQEQA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccactactcgccctcgccgtttgcgtcaaacttctcaactgcgccgtatggtg
cgggaaacggttttaacccctgatgatttaatttatcctttgtttgccgtaccgggagag
ggaattgctagcgaagttaaatctatgccgggagtgtttcaactttccgtcgataaaatt
gtccaagaagccaaagaagtctatgatttaggtattccttcgattattctttttggtatt
cccgaagataaagataccgatgcaaccggagcttggcatgactgcggtatagtccaaaaa
gccgctaccgccgtaaaagaagccgttccggatttaattgtcattgcggatacctgtctg
tgtgaatataccaatcatggacactgtggttacttagaagtcggagatttaagcggacgg
gtcttaaatgatcctaccctagaattattgaaaaaaacggctgtctctcaagctaaagcc
ggagccgatattattgctccctctgggatgatggatgggtttgtcaccactattcgtcaa
gcgttggatgaggcgggttttgaagatactccgattctttcctatgccgctaaatatgcc
tctgcctattatgggcctttccgagatgcggcggactctacgccccaatttggcgatcgc
cgtacttatcagatggatccggccaatgctagagaagccctcaaagaagtagaattagac
attgcagaaggggcggatatgttgatggttaaacctgccctatcttatatggatattatc
tggcgagttaaggaaatcactaacttacccgttgctgcttacaatgtgtctggggaatat
tctatgattaaagcggcagcccttaacggttggattgatgagcaacgagtcaccctagaa
actttaattagttttaaacgggcgggggctgatttaattttgacctatcatgctaaagat
gcggctcgttggttacaagaacaagcttaa

DBGET integrated database retrieval system