KEGG   Cyanothece sp. PCC 7424: PCC7424_5220Help
Entry
PCC7424_5220      CDS       T00808                                 

Definition
(GenBank) signal transduction histidine kinase, LytS
Organism
cyc  Cyanothece sp. PCC 7424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Apolipoprotein OmpH DUF1002 Baculo_PEP_C DUF4164 DUF445 FliD_C DUF4407 DUF5082 ApoO
Motif
Other DBs
NCBI-ProteinID: ACK73568
UniProt: B7KI81
Position
5796901..5797689
Genome map
AA seq 262 aa AA seqDB search
MLTSDSLKERLNQALQQAQTSPNSDPGNIREILKETIAQSAQESQEDPEKLHSIIKESVS
ATLDTFLEKGQESQEDITACLEGIIEGITYSKRQEISQNQAEIQRLQTQVDSEEQKLDNQ
IDTALAEIKTTVQDRSEKVKQAIDSAIHNLKDSEEIGLLQKRYAQLKAQLAVIQANLASR
YGEEFDEIKRYLDEAKTWYDRAQQNPENFSKKIETKHQEFESKLGETGTALARKEKQVKQ
LLRELWNSLREAFQDHKDSGVK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttaacatctgactcattaaaagaaagattaaatcaggcgttgcaacaagctcaaaca
tcccccaattctgatccgggaaatattcgagaaattcttaaagaaaccatcgctcaatct
gcacaagaatctcaagaagatccggaaaaacttcactcaattattaaagagtctgtctcg
gcaacgcttgatactttcttagaaaaaggtcaagaaagtcaagaagatataacggcttgt
ttagaaggaattattgaaggtatcacttattccaaacgtcaagaaatctctcaaaatcaa
gctgaaattcaacggcttcaaactcaagttgactcggaagaacaaaaattagataatcaa
attgataccgctttagctgaaattaaaaccacagttcaagaccgttcagaaaaggtaaaa
caagctattgattccgctattcataatctaaaagatagtgaagaaataggtcttttacaa
aaacgctatgctcaactgaaagcccagttagccgtgattcaagctaacttagcgagtcgt
tatggagaagaatttgatgaaattaagcgttatttagatgaagccaaaacttggtacgat
cgcgctcaacaaaatcccgaaaatttctcgaaaaaaatagaaactaaacatcaagaattt
gaatctaaattaggagaaacgggaacagccttagctcgaaaagaaaaacaagttaaacag
cttttgagagaattatggaattctctaagagaagcgtttcaagatcacaaagactcagga
gtaaagtaa

DBGET integrated database retrieval system