KEGG   Rippkaea orientalis PCC 8802: Cyan8802_0919Help
Entry
Cyan8802_0919     CDS       T00968                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00520  Amino sugar and nucleotide sugar metabolism
cyh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cyan8802_0919
Enzymes [BR:cyh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Cyan8802_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind KR adh_short NmrA
Motif
Other DBs
NCBI-ProteinID: ACU99853
Position
936632..937558
Genome map
AA seq 308 aa AA seqDB search
MRILVTGGAGFIGSHLIDRLMEQGHDVLCLDNFYTGHKRNILKWLNNPYFELIRHDITEP
IRLEVDQIYHLACPASPVHYQFNPVKTIKTNVLGTLYMLGLAKRVNARLLLASTSEVYGD
PDVHPQPEEYRGNVNCTGLRACYDEGKRVAETLAFEYHREHKVDIRVARIFNTYGPRMLE
NDGRVVSNFIVQALQGKPLTVYGDGSQTRSFCYVSDLVEGLIRLMNNDYIGPINLGNPGE
YTILELAQIIQGMINPGVELIFKPLPQDDPRQRQPDITKAKHYLGWEPTIPLKEGLELAI
SDFRQRVS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcctagttacaggcggtgctggtttcatcggctctcacttaatcgatagatta
atggaacaaggccacgatgttctgtgcttagataacttctataccggtcacaaacgtaat
atcctaaaatggcttaataatccttattttgaattaattcgccatgacattaccgaaccg
attcggctagaagttgatcaaatttatcatcttgcttgtccagcctctcccgtacattac
caatttaaccccgttaaaaccattaaaacaaatgtactgggaaccttgtatatgctagga
ttagccaagcgggttaacgccagactactcttagcttctacctccgaagtctacggtgat
cccgatgtccatccccaacccgaagaatatcgaggtaatgttaattgtacgggactgcga
gcttgctacgacgaaggaaaacgggtagcagaaaccctcgcttttgaatatcatcgagag
cataaagtcgatattcgggttgctcgtatttttaacacctatggacctcggatgttagaa
aatgacggtcgtgtcgttagtaactttattgttcaagctttacaaggaaaacctctaacc
gtgtatggagatggctctcaaacgcgaagtttttgctacgtttctgacttagtagaaggg
ttaatccgtctaatgaacaatgattacataggaccaattaatttaggcaatcctggggaa
tatactatcttagaattggctcaaatcatccaaggaatgattaatcctggcgtagaatta
atctttaaacccttaccccaagatgatcctcgacaaagacaacccgatattaccaaagct
aaacactatttagggtgggaacccactattcccttaaaagaaggcttagaattggcgatc
tcagattttcgacaacgggtttcctaa

DBGET integrated database retrieval system