KEGG   Cyanothece sp. PCC 8802: Cyan8802_1129Help
Entry
Cyan8802_1129     CDS       T00968                                 

Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00230  Purine metabolism
cyh00670  One carbon pool by folate
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01130  Biosynthesis of antibiotics
Module
cyh_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cyan8802_1129
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Cyan8802_1129
Enzymes [BR:cyh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Cyan8802_1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: ACV00059
Position
complement(1160117..1160761)
Genome map
AA seq 214 aa AA seqDB search
MKNFVTPSLISPQLSPEELVLDCPLRLGVLASGSGTNFECIVKAIHQGKLKAEIPILIYN
NPEASVKERAQRLNVPAKLLNHRHFKQREDLDQAIVEIFREYQVEWVIMAGWMRIVTHVL
LDAYPNHVINIHPSLLPSFKGIKAVEQALAAQVKITGCTVHIASSEVDSGPILLQAAVPI
LADDTPETLHARIQVQEHLIFPQAIALAAKGEKK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttgtgactcctagcttaatctctcctcaattatctcctgaagaactggtg
ttagattgtcctttaagattaggcgttttagcatcaggaagcgggacaaattttgagtgt
attgttaaagccatccatcagggaaaactcaaagcagaaatccccatattaatctataat
aatcccgaagccagtgtcaaagaaagagcccaacggttaaacgttcccgcgaaattactg
aatcatcgccacttcaaacaacgagaagatttagatcaagccattgttgaaatctttcga
gagtatcaagtagaatgggtcattatggcgggttggatgagaattgtcacccacgtttta
ttagacgcttatcccaatcatgtcattaatattcatccgagtttattacccagttttaaa
gggattaaagccgttgaacaagcattagcagcccaagtcaaaattacgggatgtaccgtt
cacattgccagttcagaagtcgatagcggaccgattttattacaagccgccgttcccatt
ttagctgatgataccccagaaacattacacgcacgtattcaagtacaagaacatcttatt
tttccccaagccattgccttagcagcaaaaggagagaagaaataa

DBGET integrated database retrieval system